KEGG   Bacillus anthracis H9401: H9401_4967Help
Entry
H9401_4967        CDS       T02028                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00260  Glycine, serine and threonine metabolism
bax00680  Methane metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
bax01230  Biosynthesis of amino acids
Module
bax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bax_M00002  Glycolysis, core module involving three-carbon compounds
bax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_4967
  Energy metabolism
   00680 Methane metabolism
    H9401_4967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_4967
Enzymes [BR:bax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H9401_4967
Membrane trafficking [BR:bax04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    H9401_4967
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H9401_4967
  Exosomal proteins of melanoma cells
   H9401_4967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3402 Fer4_12 NusB
Motif
Other DBs
NCBI-ProteinID: AFH86353
Position
4714263..4714817
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFHEWKALTNPDVYEIVIDEQCTIKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcaactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacgattggctttcatgaatggaaagctttaacg
aatcctgatgtttacgaaattgtaattgatgaacaatgtactataaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system