KEGG   Bacillus anthracis H9401: H9401_5600Help
Entry
H9401_5600        CDS       T02028                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00040  Pentose and glucuronate interconversions
bax00052  Galactose metabolism
bax00500  Starch and sucrose metabolism
bax00520  Amino sugar and nucleotide sugar metabolism
bax01100  Metabolic pathways
bax01130  Biosynthesis of antibiotics
Module
bax_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    H9401_5600
   00052 Galactose metabolism
    H9401_5600
   00500 Starch and sucrose metabolism
    H9401_5600
   00520 Amino sugar and nucleotide sugar metabolism
    H9401_5600
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     H9401_5600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AFH86985
Position
BAP1:112592..113479
Genome map
AA seq 295 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVNSGIEDIIIVSGRGK
HVIEDHFDKSYELEQTLFKKNKIKTLEDIECISNLANIHYIRQKEPKGLGHAIYCARRFI
GEEPFAVLLGDDIVSSTYPCLKQLIDVYEEHHCSVVGVQRVLETEVSKYGIVKSANQNVN
QSIIPISMLVEKPPLETAPSNLAIMGRYILKPDIFEVLKNLPVGSGGEIQLTDAINVLNK
QQKVLAFEFDGKRYDVGDKFGFIKATIDFALQRESLKEDVLSYLRNITRDKLINK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgaagattagaaaagcgattatcccagcagcgggattaggcacaagatttttacccgca
acaaaagcacaacctaaagaaatgttgccaattgtagataagccaactattcaatatatt
gttgaagaagctgttaactcaggaatagaggatattattattgtaagtgggagagggaag
catgttatagaagatcattttgataaatcttatgagctagaacaaactttatttaagaaa
aacaaaataaagactcttgaagacattgaatgcatttctaatttagcgaatatccattat
attcggcaaaaagaacctaaaggattaggacatgctatatattgtgctagacgttttata
ggtgaagaaccttttgcagttttacttggtgatgatattgttagctctacgtatccatgt
ctcaagcaattgatagatgtttatgaggaacatcactgttcagtggtaggtgttcaaagg
gtattagaaacagaagtgtctaaatatggaatagttaaatcggcaaatcaaaatgttaat
caatctattattcctatttctatgctagttgaaaaaccacctctggaaactgcaccttca
aatttagctataatgggcagatatatactaaaaccagatatttttgaggtgttaaaaaat
ttacctgtcggatcaggtggagaaattcagttaaccgatgcaatcaatgttttaaataaa
caacaaaaagtactcgcctttgaatttgatgggaaaagatatgatgtaggggataaattt
ggctttattaaagcgactatagattttgcacttcagagagaaagtctaaaagaagatgtt
ttgagttatttgagaaatatcactcgagataaacttatcaataaataa

DBGET integrated database retrieval system