KEGG   Bacillus amyloliquefaciens FZB42: RBAM_000190Help
Entry
RBAM_000190       CDS       T00582                                 

Gene name
dcK
Definition
deoxyadenosine/deoxycytidine kinase (EC:2.7.1.76)
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bay00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bay00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23535..24188)
Genome map
AA seq 217 aa AA seqDB search
MKDIHIPNNAIITVAGTVGVGKSTLTKALAKRLGFHTSLEEVDENPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNMFESGGGFVQDRSIYEDTGIFAKMHADKGTMSLTDYTTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENIINRIEKRGREMELQTNRSYWEEMYTRYEDWISGFNA
CPVLKVRIEDYDLEADEQSLEPLIEKISHVINENRNK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacattcatattccaaacaacgccattataacagtagcgggaacggtaggagtc
ggaaaatcgactttgaccaaagctttagcaaaacggctcgggtttcatacctcactcgag
gaagtggatgaaaacccttatttagagaagttttatcacgattttgaacgttggagcttc
catttacaaatttattttctggctgagcggttcaaagagcagaaaaacatgtttgaatca
ggcggcggattcgtgcaggaccgttcgatttatgaagatacaggcatattcgcaaaaatg
catgccgataaaggaaccatgtcgctgacagattacacaacatacacaagcctatttgag
gcgatggtcatgacgccgtacttcccgcatcctgatgttttgatctatttagaaggcgac
cttgaaaacattataaaccggattgaaaagcggggccgcgagatggagctgcagacaaac
cgctcttattgggaagagatgtatacacggtacgaagactggatcagcggttttaacgcc
tgccctgtgctgaaagtgcgcattgaagattatgaccttgaagctgatgaacagtcactg
gaacctttgatcgaaaaaatcagtcacgtgatcaacgaaaacagaaataaataa

DBGET integrated database retrieval system