KEGG   Bacillus velezensis FZB42: RBAM_000550Help
Entry
RBAM_000550       CDS       T00582                                 

Gene name
ispE
Definition
(GenBank) IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00900  Terpenoid backbone biosynthesis
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01130  Biosynthesis of antibiotics
Module
bay_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RBAM_000550 (ispE)
Enzymes [BR:bay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     RBAM_000550 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ABS72495
UniProt: A7Z0G9
Position
54263..55132
Genome map
AA seq 289 aa AA seqDB search
MRILEKAPAKINLSLDVTSKRPDGYHEVEMIMTTIDLADRIELTELPENVIRVASHNRFV
PDDQRNLAYQAAKLLKERFQVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWDLK
LSVEELAELGAEIGSDVSFCVYGGTALATGRGEKIRHISAPPHCWVVLAKPTIGVSTAEV
YRRLNLQQVRHPDVQAMIDAIEEKSFQKVCGQLGNVLESVTLSLHPEVAMIKNQMKRFGA
DAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagaaaaagcgccggccaaaatcaatctgtccctcgatgtgacaagtaaa
cgcccggatggttatcacgaagtggagatgatcatgacgacaattgatttggcagatcgg
attgaactgacagaactgcccgaaaacgttatcagagtggcgtcgcataatcgctttgtt
ccggatgatcaaaggaatctggcttatcaggcagccaaactgcttaaagaacgatttcaa
gtcaaaaaaggcgtttccattatgattacaaaagtgatccctgtagcggcagggcttgcc
ggcggaagcagcgatgcggcagccacgctcagagggctgaacaggctttgggatttaaag
ctttctgtcgaagagctcgcggagcttggagctgaaatcggttcagacgtgtccttctgt
gtatacggaggcactgccctggcaaccggacgcggtgagaagatcaggcacatcagtgct
ccgcctcattgctgggtcgtgcttgccaaaccgacgatcggggtatcaactgccgaagtg
taccgccggctgaacttacagcaggttcggcatcctgatgtgcaggcgatgattgacgcg
attgaagaaaaaagcttccaaaaggtatgcggacaattaggaaacgtattggagtcagtt
acgctcagcctccatcccgaggtggcgatgattaaaaatcaaatgaaacgcttcggcgct
gatgcggtgttaatgagcggaagcggaccgactgtattcggtttggttcaatacgaatcg
aaggtgcagcggatttataacgggttaagaggtttctgtgatcaagtgtacgcggtgcgg
atgatcggcgaacagaatgctcttgattaa

DBGET integrated database retrieval system