KEGG   Bacillus velezensis FZB42: RBAM_000880Help
Entry
RBAM_000880       CDS       T00582                                 

Gene name
sul
Definition
(GenBank) Sul
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00790  Folate biosynthesis
bay01100  Metabolic pathways
Module
bay_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RBAM_000880 (sul)
Enzymes [BR:bay01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     RBAM_000880 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ABS72526
UniProt: A7Z0K0
Position
86368..87225
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLVMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPVIERITSELDIPLSIDTYKASVADEAVKAG
ASILNDIWGAKGDPDMASVAAAHGVPIILMHNRMERNYNDLIPDMLADLMESVKIAAEAG
VTDENMILDPGIGFAKNYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKEIARMTKMMDAMLNKGGVHYG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctttcc
tataaagagaagacgctcgttatggggatattaaatgtaacgccagactccttctctgac
ggcggcaaatacgacagtacggaaagggcgcttctgcatgcggcgaagatggctgaagaa
ggggcgcatatcatagatatcggcggtgaatcgacaagacccggcgcatcactcgtgtcg
gctgatgaggaaatgtcccgagtcatccccgtcatagaacggattacaagcgagctggac
attccgctttcaatcgatacgtacaaagcgtccgtggcagacgaagcggtcaaagcggga
gcctctatccttaatgacatctggggggcgaaaggtgatcctgacatggcgtcagtagcc
gccgcacacggggttccgattatcttaatgcataatcgcatggaaagaaactacaacgat
cttattcctgatatgcttgcagacttgatggaaagcgtaaaaattgccgcagaagccggc
gtcacagatgaaaatatgattctggatccggggatcggctttgcgaaaaactatgaggac
aatctggctgtcatgaacaagctggaggtgttcagcgggttaggttatccgctgcttctg
gcgacatcgagaaaaaggttcatcggccgtgtgcttgaccttccccctgaagaacgtgcc
gagggaacgggagcgacagtgtgccttggcgtccaaaaaggctgcgacattgtgagggtc
cacgatgtcaaagagatcgcaagaatgacgaagatgatggatgctatgttgaacaaagga
ggcgtacattatggataa

DBGET integrated database retrieval system