KEGG   Bacillus amyloliquefaciens FZB42: RBAM_001170Help
Entry
RBAM_001170       CDS       T00582                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bay00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
111773..113224
Genome map
AA seq 483 aa AA seqDB search
MGNEVRVRYAPSPTGHLHIGNARTALFNYLFARSQGGKFIIRIEDTDKKRNIEGGEQSQL
NYLKWLGMDWDESVDIGGEYGPYRQSERNDIYKKYYEELLEKGLAYKCFCTEEELEKERE
EQIARGEMPRYSGKHRNLTQEEQERFLAEGRQPSIRFRVPEGKIIAFNDIVKGEISFESD
GIGDFVIVKKDGTPTYNFAVAIDDYLMKMTHVLRGEDHISNTPKQIMIFQAFGWDVPVFG
HMTLIVNESRKKLSKRDESIIQFIEQYDELGYLPEALFNFIGLLGWSPVGEEELFTREQF
IEIFDVNRLSKSPALFDMHKLKWVNNQYVKALDLDQVVELTLPHLQKAGKVGTELSAEEQ
EWVRKLISLYHEQLSYGAEIVELTDLFFKDEIEYNQEAKAVLEEEQVPEVLSVFAAKLEE
LEEFTPELIKASIKAVQKETGHKGKKLFMPIRVAVTGQTHGPELPQAIELIGRETAVRRL
KSI
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagtacgcgttcgttatgcaccgagtccgaccggacatttgcatatcggt
aacgccagaacagcgctttttaactatttatttgcccgcagccaaggcggaaagtttatt
atccggattgaggatacggacaaaaagcgaaatattgaaggcggagagcaaagccagctc
aactatttgaaatggctcggcatggactgggatgaaagtgtggatatcggcggagaatac
ggcccgtaccgccagtctgagcgtaacgacatttacaaaaagtactatgaagagcttctt
gaaaaagggcttgcttataaatgtttctgtacggaagaagaacttgagaaagagcgtgaa
gagcaaatcgcccgcggggaaatgccgcgctattccggcaaacacagaaacctgactcag
gaagagcaggagcggtttttagccgaaggcagacagccgagcatccgtttccgcgtgccg
gaagggaaaatcatcgcatttaacgatatcgtaaaaggtgagatttcttttgaatcagac
ggcatcggcgactttgtcatcgtcaaaaaagacggaacaccgacgtataactttgccgtc
gcgattgacgattacttaatgaaaatgacgcacgtgctccgcggtgaggatcacatttca
aatacaccgaaacagatcatgattttccaggcattcggctgggatgttcctgtcttcgga
catatgacgcttatcgtaaacgaaagccgcaaaaaattaagtaaacgtgatgaatcaatt
atccagtttattgagcagtatgatgagctgggttacctgcctgaagcgctgtttaacttt
atcggacttctcggctggtctcccgtcggtgaagaagagcttttcacaagagaacaattc
attgaaatttttgatgtaaatcgtttgtctaagtcaccggctctgtttgatatgcataaa
ctgaaatgggtcaacaaccaatacgtcaaagcgctggatcttgatcaagtggttgagctg
accctgccgcacctgcaaaaagcaggaaaagtcggcactgagctttctgccgaggagcag
gaatgggttcgtaaattaatttctctttaccatgagcaattgagctacggcgctgaaatt
gtcgagctgactgatttgttctttaaagatgagatcgagtataatcaagaggcaaaagcc
gttctggaagaggaacaggtgcctgaagtgctcagcgtctttgctgcgaagcttgaagag
cttgaagaatttacgcctgagctgatcaaagcctcaatcaaagctgttcagaaagaaaca
ggccataaaggcaaaaagctgttcatgccgattcgtgtagcggttaccggtcagacacac
ggtcctgagcttccgcaggccattgagctgatcggcagagaaacagccgtcagacgcctg
aaaagcatttaa

DBGET integrated database retrieval system