KEGG   Bacillus amyloliquefaciens FZB42: RBAM_002150Help
Entry
RBAM_002150       CDS       T00582                                 

Gene name
ybbD
Definition
hypothetical protein (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    RBAM_002150 (ybbD)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    RBAM_002150 (ybbD)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     RBAM_002150 (ybbD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(191148..193061)
Genome map
AA seq 637 aa AA seqDB search
MKLVISAVLLLFIVFGTHHVSTKPDIPSQAEQAVSRMTLDEKLGQMLMPDFRNWQKKGQS
SPEALTQMNKEVAGLIQKYRFGGVILFAENVKNTEQTVRLTDAFQKASPDIPLLLSIDQE
GGIVTRLGEGTHFPGNMALGAARKTAYASQTGAIIGKELKALGINTNFAPVLDINNNPGN
PVIGVRSFSSDRDLTASLGLASMKAQQKQDVAAAVKHFPGHGDTDVDSHYGLPLVTHNQE
RLRQIELYPFRKAIQAGADMIMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKVMTHLL
RGEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPAQVTSLQTENRFARVH
SALKKAVQKGEIPLQQINKSAERIISLKIKRGIYPAPKKTNLKKKIAKAKKTVGSKNHLK
AEKQIAERSVTVLQNKNRTLPFKPKKNSRVLIAAPYEDQTASMEQTIRQLIKKKKIRPVT
ISKMNFAERTFHDEHKKQISDADYVITGSYVVKNDPVVNDGVIDDSVTDPGKWTTAFPRA
VMKAAQSNQKPFVLMSLRNPYDAANFEEAEALIAVYGFKGYTDGQFLQPNIPAGVEAIFG
QTKPQGRLPADIPSVTHPGTTLYPYGFGINLKTGKPL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcatctcagctgtattactgttgttcattgttttcggcacgcatcatgta
tcgacaaaaccggacattccgtcacaggcggaacaagcggtatcccgtatgacattagat
gaaaaattagggcagatgctcatgcctgattttcgcaattggcaaaaaaaggggcagtca
tcacctgaggctcttacccaaatgaataaagaagtcgcagggcttattcaaaagtaccgg
ttcggcggcgttatcttatttgcagaaaatgtaaaaaacactgagcaaacggtacgcctg
acagatgcctttcaaaaggcgagccctgacattccgctattattaagcattgatcaggag
ggcggcatcgtaactagacttggtgagggcactcatttcccaggcaatatggcgctcgga
gccgctagaaaaacagcctacgcgtcccagaccggcgccattatcgggaaagaactgaaa
gcactcggcattaatacgaacttcgctcccgttctcgatatcaataataatcccggaaac
cctgtcatcggcgtcaggtcgttcagttcagaccgagatctgacagcttcactcggtctt
gcctcaatgaaggctcagcaaaagcaggatgtcgctgccgccgtcaaacatttcccggga
cacggcgacacggatgtcgacagccactacggtcttccgcttgtcacccacaatcaagaa
aggctgcgtcagattgaactttatccgttccggaaggccattcaggccggagctgatatg
atcatgacagcccatgtgcaatttcccgcgtttgacgatacaacctataaaagcaagctg
gacggttcagacatcctcgtacccgccacactctcgaaaaaagtgatgactcatcttctc
cgtggagaaatgggatttaacggcgtcatcgttacggatgcattaaatatgaaagccatt
gccgatcatttcggccaggaagaggcggtcgtcatggccgtaaaagcaggagtcgatatt
gccctgatgccggcccaagtgacatcgctgcaaacggaaaaccgctttgcccgggttcat
tccgctttaaaaaaggcggtacaaaaaggggaaattccgctgcagcaaattaacaaatca
gcggaacgcatcatttccctgaaaataaaacgagggatatatcccgccccgaaaaagaca
aatctgaaaaagaagattgcaaaagcaaagaaaaccgtcggcagcaaaaatcatctgaaa
gctgaaaaacaaatcgcggaaaggtccgtcaccgtcttacaaaacaaaaaccgcacgctc
ccattcaaaccgaaaaagaacagccgcgttctcattgccgctccatatgaagatcaaaca
gcgtcaatggaacaaaccattcggcagctcatcaagaagaaaaaaatccggccggtaacc
atcagtaaaatgaacttcgccgagcgcacatttcatgatgaacacaaaaagcagatatct
gacgctgattacgtgattacaggctcatatgttgtgaaaaatgatcctgtcgtaaacgac
ggcgtgattgacgattccgtcacagatcccggcaagtggacgactgcatttccgcgggcc
gtcatgaaagccgcacaatcgaaccaaaaaccctttgtgctgatgagcctgcgtaatcca
tatgacgctgcgaactttgaagaagctgaagcccttatcgcagtctacggctttaaagga
tatacagacggacaatttctccagccaaacattccggcaggcgttgaagcgatattcgga
cagacaaaaccgcaaggcaggctgcccgctgacattccttccgtcacgcatccgggaacg
acactgtatccttatggtttcggtatcaatctgaagaccggaaaaccgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system