KEGG   Bacillus velezensis FZB42: RBAM_003490Help
Entry
RBAM_003490       CDS       T00582                                 

Gene name
nasF
Definition
(GenBank) NasF
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00860  Porphyrin and chlorophyll metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RBAM_003490 (nasF)
Enzymes [BR:bay01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     RBAM_003490 (nasF)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RBAM_003490 (nasF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase HEM4 RRM_7
Motif
Other DBs
NCBI-ProteinID: ABS72748
UniProt: A7Z172
Position
complement(323788..325227)
Genome map
AA seq 479 aa AA seqDB search
MKNGIVYFVGAGPGDPGLITVKGKQALEKADIILYDRLANPKFLEYASPDCRFIYCGKLP
DRHFMKQSEINALLIEKAAEGFTVVRLKGGDPSVFGRVGEEAEALHQHGIRYEMVPGITS
GIAAPLYAGVPVTHRDFASSFAMITAHDTSLHGRPNLDWEGLARSVQTLVFYMGVKNLSF
ICRKLTEYGKSPSVPVLVIQWGTWGRQRSVKGTLQDIHEKVQSQNITNPAIIVIGDIVNF
QTHSWFESKPFIGRHIMVVTHGDEEHTLTDKLREYGADVIEWPKRIVKKMPANENILKQI
STFEQLFFTSRLAVCEFFDTLAFKQIDIRRVTASLNAATEAAKTELTKRGFLLSECQIDS
PHSLIVGSRQAAENLSDSKSCPFYITHEHIADERFTSMIERTISESPLQMIICTGKESAQ
HLISAGKQIGISPDPSANRPPVICMGEDVPAGCGFTAVKNQEQLFAFIRNEMKDMLVHS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacggaatcgtatattttgtcggtgccggaccaggagacccggggctgatcacc
gtaaaaggaaaacaggctctggagaaagcggatattattttgtatgaccggctcgcaaac
ccaaagtttcttgaatatgcctcaccggactgccggttcatttattgcggaaagctgccc
gaccgccattttatgaaacagtctgagataaatgccctgctgattgaaaaagcggcggag
ggcttcaccgttgtccgcttgaaaggcggagacccaagtgtgttcggcagagtcggcgaa
gaagcagaggcgcttcatcagcacggcatccgctacgaaatggtgcccggcatcacctcg
ggaatcgcagcgccgctgtatgcgggagtccccgtcactcatcgtgatttcgcttcgtcc
ttcgcgatgatcaccgctcatgatacatcattgcacggcaggccgaatctcgactgggaa
gggcttgcccgaagcgttcaaacgcttgtgttttacatgggcgttaaaaatctgtcattt
atatgccgtaagcttacggagtacggaaaatccccttccgttcccgtactcgtcattcaa
tgggggacgtgggggcggcagcggagcgttaaaggaacgcttcaggatatccatgaaaaa
gttcaaagccaaaacatcaccaaccctgccattatcgtcatcggtgatattgtcaatttt
caaacacacagctggtttgaaagcaagccgttcatcgggcggcatatcatggttgtcact
catggcgatgaagaacatacattgacagacaagctgcgcgagtatggcgccgatgttatt
gaatggccgaagcggatcgttaaaaaaatgcccgcaaacgaaaacatcctgaaacagatc
agcacctttgaacaactatttttcacatcacgccttgcggtatgcgaattctttgacaca
ctggctttcaagcagatcgacatccgccgggtgaccgcaagcctgaatgcagcgactgag
gccgcaaagacggaactgacaaaacggggctttctcctatccgaatgtcaaattgattct
ccgcattcactcattgtaggaagccgtcaagcagcagaaaacttgtcagactcaaaatca
tgcccgttttatatcacccatgaacatatcgcagatgagcggttcacttccatgatcgaa
cgcacgatcagtgagtctcctctgcaaatgattatctgtactggcaaagaatccgctcag
catttgatcagcgccggaaaacaaatcggcatatcaccggatccgtcagcaaaccgccct
cccgtcatctgcatgggcgaagacgtccccgccggctgcgggtttaccgccgtgaaaaat
caggaacagttatttgcgtttatacgaaatgaaatgaaagacatgctcgttcacagctga

DBGET integrated database retrieval system