KEGG   Bacillus amyloliquefaciens FZB42: RBAM_007390Help
Entry
RBAM_007390       CDS       T00582                                 

Gene name
yetO
Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RBAM_007390 (yetO)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RBAM_007390 (yetO)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RBAM_007390 (yetO)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RBAM_007390 (yetO)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RBAM_007390 (yetO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722994..726176
Genome map
AA seq 1060 aa AA seqDB search
MKETGPIPQPKTFGPLGNLPLLDKDKPTMSLIKLANEQGPIFQLHTPAGAIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHHILMPTFSQRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSGGRDEKDLLARML
NVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAYEEADRVL
TDPVPSYKQVLDLTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITPKDRISVLIP
QLHRDKDAWGDNAEEFYPERFEHPDRVPHHAYKPFGNGQRACIGMQFALHEATLVLGMIL
QHFTFIDHTDYELDIKQTLTIKPGDFHIRVRPRNKEDVAAALPAAEKAAEDVGKEKRETK
GASIIGLDNRPLLILYGSDTGTAEGVARELADTAGMHGVRTETAPLNDRIGKLPKEGALL
IITSSYNGKPPSNAGQFVQWLEEVKPGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKLA
EKGAERFSSRGEGDVSGDFEGKLDEWKKSMWTDAMKAFGLKLNENAEKERSALGLQFVSG
LGGSPLAQTYEAVYASVAENRELQAPESGRSTRHIEITLPKEAAYHEGDHLGVLPVNSKE
QVSRVLRRFNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREMA
AYTVCPPHKRELEDFLEEGVYQEQILTSRVSMLDLLEKYEACELPFERFLELLRPLKPRY
YSISSSPRKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRGPEDGIVMFVRTPETRF
RLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKKEGKELGEAHLYFGCRNDHDFIYRDEL
EAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAKDAGALISILGRGGHLYVCGDGSKMAPDV
EATLQKAYQSVRETDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaggtccgattccgcagccgaagacattcggcccgctcggcaatcttcct
ttgcttgataaagacaagcctacaatgtcgctgatcaaactggcaaacgagcaggggcct
atttttcagctccatacgccggcaggcgccattatcgtcgtgtccggccatgaactggtg
aaagaggtttgtgatgaagagcggttcgataaaagcattgaaggggctttagagaaagtc
cgggcgttttccggtgacgggctgtttacaagctggacgcatgagcctaactggcgaaag
gcgcatcatattctgatgccgaccttcagccagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggctaggctgaacccggatgaggcc
gttgatgtgcctgctgatatgacccggctgacgcttgatacgattgggctttgcggcttt
aactatcggtttaacagctattacagggaaacgcctcatccgtttatcaacagcatggtg
cgcgcccttgatgaagcgatgcaccaaatgcagcgccttgatgttcaggataagcttatg
atcagaacgaagcgccaatttcatcatgacattcaggcgatgttttcgttagtagacagt
attatcgcagagcgccggtcaggcggccgggatgaaaaggatctgctggccagaatgctg
aatgtggaagacccggaaacgggcgaaaaacttgatgatgaaaatatccggtttcaaatc
atcacgtttttaattgcgggccacgaaacgacaagcggcctgctttcctttgccatctac
tttctgctgaaacatccccgtgttttggaaaaagcctatgaggaagctgatcgggtattg
accgatcccgttccttcatataaacaagtgctggatcttacttatatccgaatgattttg
caggagtcattgcgtttatggccgaccgcgcctgcgttcagcctttatgcgaaagaggat
acggtgatcggcgggaaatatccgatcacgccgaaagacagaatttccgtcttaattccc
cagcttcaccgtgataaagacgcgtggggagacaatgcggaggaattttatccggagcgg
tttgaacatcctgatcgagtgcctcaccatgcgtataagccgttcggaaacggtcagagg
gcgtgtatcggtatgcagttcgccctgcatgaagcaactcttgttctggggatgattctg
cagcattttacctttatcgatcacaccgattatgagctcgatattaaacagacactgacg
atcaagcccggcgactttcatatccgggtgcggccgagaaacaaagaagacgttgcggct
gctctcccggcggctgaaaaagcggcggaagacgtcggaaaagaaaaacgggaaacaaaa
ggcgcatccattatcgggcttgataaccgaccgcttctgattctgtacggctcagatacg
ggaaccgcagaaggcgtggcgcgggagcttgccgatactgccgggatgcacggcgtccgg
actgaaacggcgcctttaaatgaccggatcggaaaactgccgaaagaaggagctctcttg
atcattacgtcctcttataacggaaagcctccgagcaacgcgggacaattcgttcaatgg
cttgaagaagtcaaacccggggagctggaaggcgtccgatatgccgtcttcggctgcggt
gatcataactgggcggcgacatatcaggccgtgccgaggcttattgatgagaagcttgcc
gaaaaaggggcggaacgcttttcctcccgaggcgagggggacgtcagcggcgattttgaa
ggaaagcttgatgaatggaaaaaaagcatgtggacggacgccatgaaggcattcggtctc
aagctgaatgaaaatgccgaaaaagagcgaagtgcgctgggccttcaatttgtcagcggg
cttggggggtctcctttggcacagacgtatgaagcggtttacgcatccgttgcggaaaac
agggaacttcaggcgccggaaagcggccggagcacaaggcatatcgaaatcactctgccg
aaagaggctgcctatcatgaaggggatcatctcggcgtgctgccggtaaacagcaaagag
caggtcagccgtgttctccgccgattcaatctgaacgggaatgatcaagtgctgctgaca
gccagcggacagagcgcggctcatctcccgctcgatcggccggtcaggctgcatgatctt
ctgagcagctgtgtcgaattgcaggaagcggcatcaagggctcaaatccgggaaatggct
gcttatacggtctgcccgccgcataaacgggaattggaagattttcttgaggagggcgtc
tatcaggagcaaatcttaacatcgcgcgtctcgatgctcgatctccttgaaaaatatgaa
gcgtgtgaacttccgtttgagcgatttctggagcttttgcgcccgttgaagccgcggtat
tattcgatttcaagttcgccccggaaacatcccgggcaggcttcaattaccgtcggcgtc
gttcgcggccccgcccggagcggtttgggtgagtatcgcggagtcgcttcgaattattta
gcggaccgcggccctgaggatggtatcgtgatgtttgtccgcactccggaaacacgattc
cggctgccggaagatccggaaaaaccgattattatggtcggtcccggcacaggagtcgcc
ccgttccgcggatttctgcaggcccgggcggcgttaaaaaaagaaggaaaagagctgggg
gaggctcatctgtatttcggatgcagaaacgatcatgattttatttaccgtgacgagctt
gaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgcaaagaaggc
gtaccgaaaacgtatgtgcagcacttaatggcgaaagacgccggcgctttaatttccatc
ctcggccggggagggcacctctacgtatgcggcgacggcagcaaaatggcgcccgatgta
gaggcaacgctgcaaaaagcgtatcagtcggtccgcgaaacagacgaacggcaagcgcaa
gaatggcttttggacctccagacaaaaggcatttacgcaaaagatgtttgggcggggatt
tga

DBGET integrated database retrieval system