KEGG   Bacillus amyloliquefaciens FZB42: RBAM_010950Help
Entry
RBAM_010950       CDS       T00582                                 

Gene name
asnO
Definition
(RefSeq) AsnO (EC:6.3.5.4)
  KO
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RBAM_010950 (asnO)
Enzymes [BR:bay01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     RBAM_010950 (asnO)
Peptidases [BR:bay01002]
 Cysteine Peptidases
  Family C44
   RBAM_010950 (asnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072854..1074695
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWVDFQKQLVQEKHIMNNMIDTLSKRGPDDSNVWGEPHVLFGHKRLSVVDIEGGR
QPMACTHQEETYTIIYNGELYNTEELRKELQARGHRFERTSDTEVLLHSYIEWREECVDR
LNGIFAFAIWDEKRKRLFGARDRLGVKPFFYKEHGSSFLFGSELKAILAHPDVKARTDSG
GLAEVFGLGPSRTPGCGVFKGIHEVRPAHAFTFSKDGLSIWRYWNVKSEKHTDSLDETAA
HIRYLFQDAVTRQLVSDVPVCTFLSGGLDSSAITAIAAAHFEKQGRDPLHTYSIDYEENS
KFFKASAFQPNDDGPWIDKMTNAFGTQHHKCVITQDQLVEHLEESVLVRDLPGMADVDSS
LLWFCREIKKDFVVSLSGECADEIFGGYPWFHTAAEEDGFPWMRSTEERITLLDEKWQKR
LNLREYVNARYEETIAETPLLDGETGTDKARRQLFYLNMLWFMTNLLDRKDRMSMGASLE
VRVPFADHRLVEYVWNIPWEMKMHGSREKGILRKALEGLLPEDILYRKKSPYPKTHHPKY
TQGVTEWLKTILQQKDSVLHTLLDRKKLEMLLETEGSSFQVPWFGQLMKGPQLIAHLAQI
HTWFEAYRIDIEE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcgggttgggtcgattttcaaaagcagctcgtccaagagaaacatatt
atgaacaatatgatagacactctttcaaaacgagggcctgatgattcaaacgtctgggga
gagccccatgttttattcggacataaaagactttcggtcgttgacattgaaggcggccgc
cagccgatggcctgcacgcatcaagaggaaacgtacaccatcatttataatggcgagctg
tataacacggaggaattgcggaaggagcttcaggcgaggggccaccgttttgagaggacc
tctgatactgaagtgctgctgcacagctatattgagtggcgggaggagtgcgtggaccgc
ttgaacggtattttcgcttttgccatctgggatgaaaagcgcaagcggctgttcggggca
agagaccggctcggcgtcaaaccgtttttttataaagaacacggctcttcctttctgttt
gggtcggaattgaaagccatccttgctcatcctgatgtgaaagcccgcacagacagcggc
ggacttgcggaagtattcggactcgggccgtccagaactccgggctgcggagtgtttaaa
ggaatccacgaggtgcgtcccgcccatgcgttcactttctcaaaggacggtttgtccata
tggcgttattggaatgtaaagagcgaaaagcatacagacagcttggatgaaaccgcggct
cacattcggtacttatttcaggatgcagtgacacgccagctcgtatctgacgtgccggtt
tgcacgtttttatcaggggggcttgattcgagcgcgataaccgcgatagccgccgctcat
tttgagaaacaaggcagagatccccttcatacttattcaattgattatgaggagaacagc
aaattttttaaagcgagcgcctttcagccgaatgatgacggcccgtggatcgataaaatg
acaaatgcattcggcacacagcatcataagtgcgtgattacgcaggatcagctggttgaa
catctggaggaatccgttctcgtcagagacctgccgggcatggctgatgttgattcctcg
ctattatggttctgccgggaaattaaaaaagattttgtcgtgagcctttccggagaatgt
gcggacgaaattttcggcggatatccgtggtttcacaccgcggcagaagaagacggattt
ccttggatgaggtcgactgaggagaggatcacgctcttggatgaaaagtggcaaaaacgg
ctgaatcttagagaatacgtgaatgcgagatatgaagaaaccattgcggaaacgccgctg
ttagacggtgagacgggaacagataaagcgagacggcagctgttttacttaaatatgctt
tggtttatgacaaatctgctcgaccgcaaagaccgaatgagcatgggcgcaagtcttgaa
gtacgggtgccgttcgccgaccacagacttgtggaatacgtttggaatattccttgggaa
atgaaaatgcatggcagccgggaaaaaggcatcttgcgaaaagcgcttgaaggactgctt
cctgaagatattttgtaccgcaaaaaaagcccttatccgaaaacgcatcacccgaaatac
acgcagggggtcacagaatggctgaaaacgattttacaacagaaagattccgtgcttcac
accctgcttgacagaaagaagctggaaatgctgctggagacagaaggttcatcttttcag
gtcccgtggttcggccagctgatgaaaggcccgcagctgatcgcccatcttgcccagatc
catacatggtttgaggcgtaccgtatcgatatagaagaataa

DBGET integrated database retrieval system