KEGG   Bacillus velezensis FZB42: RBAM_012310Help
Entry
RBAM_012310       CDS       T00582                                 

Gene name
yjjA
Definition
(GenBank) YjjA
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bay  Bacillus velezensis FZB42
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RBAM_012310 (yjjA)
Enzymes [BR:bay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RBAM_012310 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1201208..1202026
Genome map
AA seq 272 aa AA seqDB search
MGKGLNGKRIAIGGSRKTEEITRLIEKQGGTAVVRSLQGTVYLAEDQIEPDVRTFAGQKA
DWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEAKIGCRGYKTYAALKKLGITPHASDED
GTTRGLIRSLERFDFKDKKVMIQLHGEKAPVLTQFLEKNGAEVFPVLPYQHILPERETVD
KLLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGSTKELQQAFEKQVLAAAVGKVTAEAIR
DEGVKRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattgaacgggaaacggattgccatcggcggttcgcggaaaacagaagag
atcacaagattaatagaaaagcagggcggaacggcggtcgtccgttccctccaaggaacc
gtatacctggcggaggatcaaattgaacccgacgtaagaacatttgccgggcaaaaagcc
gactgggtaatattcaccacaggcatcggtacggaaacgttattgtcggtatcggaaaaa
atcggtctgaaagaagaatttttagcggccgttcatgaagcgaaaatcggctgcagaggc
tataaaacatatgcggccttaaaaaagctcggcatcacgccgcatgcctcagatgaagac
ggtacaacaagagggctgatccgctccttggaacgatttgactttaaagataaaaaagtc
atgatacagcttcatggcgaaaaagcgccggtcttaacgcagttccttgagaaaaacgga
gcggaggtattccctgttctgccgtatcagcatattctgcctgaaagggagacggttgat
aaactgctgggagagctgttaaacggagaggtcgatgccgtatgttttacaacagccatt
caagtgcgctctctctttgattatgcaaaagaaaaaggatccacaaaagaattgcagcag
gcattcgaaaaacaagtgcttgccgccgcagtcggcaaagtgacggctgaagcgatccgg
gatgaaggggtaaagagggtccttgctccggacattgagcggatgggagcgatgattatt
gaattatcccgttactatgaatctctgaccttgtcataa

DBGET integrated database retrieval system