KEGG   Bacillus velezensis FZB42: RBAM_013400Help
Entry
RBAM_013400       CDS       T00582                                 

Gene name
mtnD
Definition
(GenBank) MtnD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00270  Cysteine and methionine metabolism
bay01100  Metabolic pathways
Module
bay_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    RBAM_013400 (mtnD)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     RBAM_013400 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     RBAM_013400 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding DUF3047 DUF4404
Motif
Other DBs
NCBI-ProteinID: ABS73703
UniProt: A7Z3X7
Position
1302476..1303012
Genome map
AA seq 178 aa AA seqDB search
MATIRIHDEKNTLIEHQEEVARFLDEQEVIYEQWNIEKLPSELSEKYDLTEDEKERILAV
FDTEIQDISARRGYQSQDVISLSDTTPNLDELLKNFQREHHHTDDEVRFIVSGHGIFVIQ
GKDGTFFDVRLNPGDLISVPENIRHYFTLQEDRRVVAIRIFVTTEGWVPIYENESVQN
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccatcagaattcatgacgaaaaaaatacgctcattgaacatcaggaagaagta
gcgcgcttcttagacgaacaagaggtgatctatgagcagtggaacattgaaaaacttccg
tctgagctttcggaaaaatacgacctaaccgaagatgaaaaagaacggattctcgcggtg
tttgacacggagattcaggacatttcagcccggcgcggatatcagtctcaggatgtcatt
tctttatcagacaccacgccgaatcttgatgaattattaaaaaacttccaaagagaacat
caccacacggatgatgaagtccgctttatcgtcagcggacacggcatcttcgtcattcaa
ggcaaagacggcacatttttcgacgtccgtttaaatccgggagatttgatttcagttccg
gagaacatccgccactactttacgcttcaggaagaccgccgggtcgtcgcaatccgaatc
ttcgtgacgactgagggctgggtgccgatttacgaaaatgaaagtgtgcaaaactga

DBGET integrated database retrieval system