KEGG   Bacillus amyloliquefaciens FZB42: RBAM_016260Help
Entry
RBAM_016260       CDS       T00582                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bay00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RBAM_016260 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    RBAM_016260 (cheB)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     RBAM_016260 (cheB)
Two-component system [BR:bay02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   RBAM_016260 (cheB)
Bacterial motility proteins [BR:bay02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    RBAM_016260 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626849..1627916
Genome map
AA seq 355 aa AA seqDB search
MIRVLVVDDSAFMRKMITDFLAAEVQIEVIGTARNGEEALKKIELLKPDVVTLDIEMPVM
NGTDTLRKIISIYKLPVIMVSSQTQQGKDRTINCLEMGAFDFITKPSGAISLDLYKIKEQ
LIERVIAAGLSRAQKPEAAVKESSIPERPALAGFERPKAKSAKQAVFIATSTGGPRALQK
VIPKLPKDLKAPVFVVQHMPEGFTASLADRLNHLSDIQVKEAENGEEAKDGWVYIAPGGK
NMTVAEEGGRLRIILDVHDTESRHKPSADYLFRSASRLSDYEKVAVIMTGMGSDGTEGVK
EMLRTGGVKTIAESDESCVVFGMPKSAIKAGLIHEIKHVEDIAASITGCVKKERV
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgtgtgcttgtcgttgatgactcagcttttatgagaaagatgattaccgatttt
ctggctgcggaagtgcagatagaagtcatcgggacagccagaaacggggaagaggcgctg
aagaaaatagagcttcttaaaccggatgttgtcacgcttgatattgaaatgccggtcatg
aacggaacggatacattgcggaagatcatcagcatatataaacttcccgtaatcatggta
tcgagccagacacagcaagggaaggaccgaacgatcaactgtctggaaatgggcgctttt
gattttatcaccaagccttccggagcgatttcacttgatctttataaaattaaagagcag
ctgattgagagggtgattgcagccgggctgtcccgcgcacaaaaacctgaggcggcagtg
aaagagtcttctatcccggaacgtccggctttggcgggatttgaaagaccgaaagcaaaa
tccgccaaacaggccgtattcatcgcgacctctacaggcggaccgcgggctctgcaaaag
gtgattccgaaactgccgaaggatttaaaggcgcctgtatttgtcgttcagcacatgcct
gaaggtttcaccgcttcacttgcagacagactcaaccatttgtcagatattcaggtcaaa
gaagcggaaaacggtgaagaagcgaaagacggatgggtgtacatcgcacccggcggaaaa
aatatgacggttgcagaggaaggcggaaggctccgcatcattcttgacgttcatgatacg
gaaagccggcataaaccgtcagccgattatttgtttcggtcggcaagccgcttatccgat
tacgaaaaggtagccgtcattatgacaggcatgggcagcgacggaaccgagggcgtaaaa
gaaatgctcagaacaggcggcgttaaaacgattgcggaatcggacgaatcctgtgttgtg
ttcggaatgccgaagtcagcgataaaggcgggcctcattcatgagattaaacatgtggaa
gatatcgcggcatccatcaccggatgtgtgaaaaaagagagggtgtga

DBGET integrated database retrieval system