KEGG   Bacillus amyloliquefaciens FZB42: RBAM_018100Help
Entry
RBAM_018100       CDS       T00582                                 

Gene name
bglC
Definition
BglC (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RBAM_018100 (bglC)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     RBAM_018100 (bglC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1863403..1864902)
Genome map
AA seq 499 aa AA seqDB search
MKRSISIFITCLLIAVLTMGGLLPSPGSAAGTKTPVAKNGQLTLKGTQLVNRDGKAVQLK
GISSHGLQWYGDFVNKDSLKWLRDDWGITVFRAAMYTADGGYIDNPSVKNKVKEAVEAAK
ELGIYVIIDWHILNDGNPNQNKEKAKEFFKEMSSLYGNTPNVIYEIANEPNGDVNWKRDI
KPYAEEVISVIRKNDPDNIIIVGTGTWSQDVNDAADDQLKDANVMYALHFYAGTHGQFLR
DKANYALSKGAPIFVTEWGTSDASGNGGVFLDQSREWLKYLDSKTISWVNWNLSDKQESS
SALKPGASKTGGWPLTDLTASGTFVRENIRGTKDSTKDGPETPAQDNPTQEKGVSVQYKA
GDGRVNSNQIRPQLHIKNNGNATVDLKDVTARYWYNVKNKGQNFDCDYAQMGCGNLTHKF
VTLHKPKQGADTYLELGFKTGTLSPGASTGNIQLRLHNDDWSNYAQSGDYSFFQSNTFKT
TKKITLHHQGKLIWGSEPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggtcaatttctatttttattacgtgtttattgattgcggtattgacaatgggc
ggcttgctgccttcgccgggatcagcagcagggacaaaaacgccagtagccaagaatggt
cagcttaccctaaaaggtacacagctcgtaaaccgagacggcaaagcggtacaattgaaa
gggatcagttcacatggattgcaatggtatggcgattttgtcaataaagacagcttaaag
tggctgagagacgattggggcatcaccgttttccgcgcggcgatgtatacggcagatggc
ggttatattgacaacccgtccgtgaaaaacaaagtaaaagaagcggttgaagcggcaaaa
gaacttgggatatatgtcatcattgactggcatatcttaaatgacggcaacccaaaccaa
aataaagagaaggcaaaagaatttttcaaggagatgtcaagtctttacggaaacacgcca
aacgtcatttatgaaattgcaaatgaaccaaacggtgacgtgaactggaagcgtgatatt
aaaccgtatgcagaagaagtgatttccgttatccgcaaaaatgatccagacaacatcatc
attgtcggaaccggtacatggagccaggatgtgaatgatgctgcagatgatcagctaaaa
gatgcaaacgtcatgtacgcgcttcatttttatgccggcacacacggccaatttttacgg
gataaagcaaactacgcactcagcaaaggagcgcctattttcgtgacggaatggggaaca
agcgatgcgtctggaaatggcggtgtattccttgaccaatcgcgggaatggctgaaatat
ctcgatagcaagaccatcagctgggtgaactggaatctttctgataagcaggaatcatcc
tcggctttaaagcccggagcatctaaaacaggcggctggccgcttacagatttaactgct
tcaggaacattcgtaagagaaaacattcgcggcactaaagattcaacgaaggacggccct
gaaacgccagcacaagataaccccacacaggaaaaaggcgtttctgtacaatacaaagca
ggggatgggcgtgtgaacagcaatcaaatccgcccgcagcttcacataaaaaataacggc
aatgcgacggttgatttaaaagatgttactgcccgttactggtataacgtgaaaaacaaa
ggccaaaactttgactgtgactacgcgcagatgggatgcggcaatctgacccacaagttt
gtgacgctgcataaacctaagcaaggtgcagatacctatctggaactggggtttaaaaca
ggaacgctgtcaccgggagcaagcacagggaatattcagcttcgtcttcacaatgatgac
tggagcaattatgcacaaagcggcgattattcctttttccaatcaaatacgtttaaaaca
acgaaaaaaatcacattacatcatcaaggaaaactgatttggggatcagaacccaattag

DBGET integrated database retrieval system