KEGG   Bacillus amyloliquefaciens FZB42: RBAM_019120Help
Entry
RBAM_019120       CDS       T00582                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBAM_019120 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RBAM_019120 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    RBAM_019120 (odhB)
Enzymes [BR:bay01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RBAM_019120 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2030347..2031594)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPANEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQPKQQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNDVK
LGFMSFFTKAVVAALKKFPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEREIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYIALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaactggagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacccgccccttcagaaagtgctccagccaatgaacaaacgaaagaggaa
gcaaaagctgaacctgctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctatca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagatgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagccgaaacagcaggctcaaaaaacacagcaaagc
tttgacaaacctgtcgaagtgcaaaaaatgtcccgccgcagacagacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgactacatttaacgaagttgacatgacg
gccgttatgaatctaagaaaacgccgcaaagaccaattccttgagcaaaacgatgtaaaa
ctcggtttcatgtcgttctttacaaaagccgtcgtggctgcattgaaaaaattcccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatt
gctgtcgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgaccgcctgacg
tttgccggcattgaaagagagatcggcgaacttgcgaagaaagcgcgaaacaataaatta
acattaggtgagctgcaaggaggctccttcacgatcacaaacggaggtacattcggatcg
cttatgtcaacaccgatcctaaacagccctcaggttgggatcttaggtatgcacaaaatt
cagctgcgcccagtagcgattgatgcggagcgctctgaaaaccgtccgatgatgtacatc
gctttatcatacgatcacagaattgtagatggtaaagaagcggtcggattccttgtcacc
attaaaaacctgcttgaagatccggaacagctgttgctggaaggataa

DBGET integrated database retrieval system