KEGG   Bacillus methylotrophicus FZB42: RBAM_020800Help
Entry
RBAM_020800       CDS       T00582                                 

Gene name
trpB
Definition
(GenBank) TrpB (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bay  Bacillus methylotrophicus FZB42
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RBAM_020800 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBAM_020800 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RBAM_020800 (trpB)
Enzymes [BR:bay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     RBAM_020800 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2178800..2180002)
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGEFGGKFVPETLMRPLEEIETAFKELKNDPVFHAEYKKLLFDYSGRPTA
LTFADRVSEYLGGAKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETGAGQHGV
AAATAAAKFGFKCTVFMGEEDVARQSLNVFRMKLLGAEVVPVTSGNGTLKDATNEAIRYW
VQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQLRRVEGTLPDKVVACVGGGSNA
MGIFQAFLDEDTELIGAEAAGKGIDTPLHAATIAKGTLGVIHGSMTYLIQDQYGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYESVTDDEAIAALRLLSETEGILPAIESAHALAKA
FEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVGTHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccaaatgaaatcggaagatacggcgaattcggcggcaaatttgtccct
gaaacattgatgcggccccttgaggaaatcgaaacggctttcaaagaattaaagaatgat
cccgtttttcatgccgaatataaaaagctattgtttgattactccggaagaccgaccgca
ttaacgttcgcagacagggtgtcagagtatttgggaggggcgaaaatctatctgaaaaga
gaagatttaaaccataccggctctcataaaattaacaacgcgttaggccagattctgctt
gccaaaaagatgggcaaaacgaaaatcatcgccgaaaccggtgcgggacagcacggtgtg
gctgccgcaacagccgctgcaaaattcggttttaagtgtacggtttttatgggtgaagaa
gacgttgcgcgtcagtcgctgaacgtattccggatgaaactgctcggcgcggaagtggtg
ccggtcacaagcggcaacggcacgctgaaagatgcgacgaatgaggcgatcaggtattgg
gtccagcattgtgaagatcatttctaccttatcggttctgtagtggggccgcatccgtat
ccgtatatcgttcgcgaatttcagaaaatcatcggcgaggaagcgaaagaacagctccgc
cgggttgaaggaacactcccggacaaggttgttgcatgtgtcggcggcggaagcaatgcg
atgggcatttttcaggcctttttagacgaagatactgagctgatcggcgccgaggctgcc
ggaaaaggaattgatacaccgctgcatgcggcaacgatcgcaaaagggacgctcggggtg
attcacggttcaatgacctatttaatacaagatcaatacgggcagattatcgaaccgtat
tccatttcagcaggccttgattacccggggatcggtcctgagcatgcctatctgcataaa
agcggccgtgtaacgtacgaaagcgtgacagacgatgaagcgattgccgcgttacgtctg
ctttctgaaacagaaggtattcttccggctattgaatctgcccacgctctggccaaagcg
tttgaaatggcaaaagacatggataaagacaaaatcattctcgtcagtttgtcgggaaga
ggagataaagatgttcatacgctgatgaatgttttggaaaacggggtggggacacatgtt
taa

DBGET integrated database retrieval system