KEGG   Bacillus amyloliquefaciens FZB42: RBAM_021400Help
Entry
RBAM_021400       CDS       T00582                                 

Gene name
ribA
Definition
bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein (EC:3.5.4.25)
Orthology
K14652  
3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Riboflavin metabolism
Metabolic pathways
Module
Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RBAM_021400 (ribA)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     RBAM_021400 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     RBAM_021400 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2233094..2234290)
Genome map
AA seq 398 aa AA seqDB search
MFHPIEEALEALKKGEVIIVVDDEDRENEGDFVALAEHATPEVVNFMATHGRGLICTPLS
EDIAGRLDLHPMVDHNTDSHETAFTVSIDHRLTKTGISAQERSFTIQALLNEESVSDDFQ
RPGHIFPLIAKKGGVLKRAGHTEAAVDLAKACGSQGAGVICEIMNEDGTMARVPELAEIA
ERHQLKMITIKDLIEYRYNITTLVNREVDITLPTDFGTFRVYGYTNEVDGKEHLAFVMGD
VPFNSEPVLVRVHSECLTGDVFASHRCDCGPQLHAALAQIAEEGRGVLLYLRQEGRGIGL
INKLKAYRLQEQGYDTVEANEALGFLPDLRNYGIGAQILRDLGVQHMKLLTNNPRKIAGL
EGYGLSISERVPLQMEASEHNKQYLQTKMKKLGHLLHF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatccgatagaagaggcgttagaggcgctgaaaaaaggtgaagtcatcattgtt
gtcgatgatgaagacagagaaaacgaaggagatttcgtagcgttggctgagcatgccacg
ccggaagtggtgaattttatggcgacccatggtagaggcctgatctgcacgccgctgtct
gaagacatcgccggccggctggatcttcacccgatggtcgatcataatacggactcacat
gagaccgcgtttacggtcagtattgaccacaggctgacaaaaacgggcatcagcgcgcag
gaacgatcctttaccattcaggcgctgttgaacgaagaatctgtgtctgacgattttcag
cgtccgggccacattttccccttaatcgcaaaaaaaggaggagtcctgaagcgggccggc
catacggaagcagccgttgaccttgcaaaagcctgcggatctcagggagcgggcgtcatt
tgtgaaattatgaatgaagacggcacaatggccagagtgccggagttagccgaaatcgcc
gaacgccaccagctgaaaatgattacgataaaagacttaatagagtaccgttacaacatt
acgacacttgtgaacagagaagttgatattacgctgccgactgacttcggcacgtttaga
gtttacggatatacaaacgaggttgacggaaaagaacatctcgcctttgtcatgggggat
gtcccgtttaacagcgaacccgttcttgtcagagtgcactcagaatgcctgacgggcgat
gtgtttgcatctcatcgctgtgattgcggacctcagcttcatgccgcgcttgcgcaaatt
gctgaagaaggccgcggcgttctattgtatttgcgccaggaaggcagaggaatcggttta
atcaataagctgaaggcgtaccgattgcaggaacaagggtatgacacggttgaagcgaac
gaagcgctcggctttctgcctgatctgcgcaactacggcatcggcgcccagattctccgc
gacttaggggttcagcatatgaaacttttaaccaataacccccggaagatcgccggcctc
gaaggatacggtctcagcatttcagaacgggtgccgcttcaaatggaagcgagtgagcat
aacaagcaatatttacagaccaaaatgaaaaaacttggacatctgcttcatttctaa

DBGET integrated database retrieval system