KEGG   Bacillus amyloliquefaciens FZB42: RBAM_024260Help
Entry
RBAM_024260       CDS       T00582                                 

Gene name
yrhJ
Definition
hypothetical protein
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RBAM_024260 (yrhJ)
  Amino acid metabolism
   00380 Tryptophan metabolism
    RBAM_024260 (yrhJ)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RBAM_024260 (yrhJ)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     RBAM_024260 (yrhJ)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     RBAM_024260 (yrhJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2544527..2547688)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLSKALLKVREFGGDGLFTSWTHEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNSLVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLKKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIAKGQPVTILT
PQLHRDKSAWGEDAELFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHTDYELTIKEALTIKPGDFKIRVKNKDVSNHQPVQNHKAEGSGHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTESGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQRIPRLIDKVLEEKGAKR
LTSIGEGDNADDFEYSQEAWEDSFWKDIMKAFHIEAAPKQTNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSKRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIR
RFGLDPNQHFKIKGRQLPHLPMDRPVNAPELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDDAAYKENVLKNRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ATSGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQKGDSAVCFIRSPQSGFALPENPKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEQDDLYKDEFDHAEKNG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLNWLEQLQAEGRYAKDVWAGM
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgctataccacagccgaaaacatacgggcctctgaaaaatctccct
cacttggaaaaagaaaaactgtcacaatcgctttggaaaattgccgaagaatacggcccg
atctttcgttttgaatttccgagctctgtcggggtcttcgtctcaggccgcgagctcgcg
gcagaagtctgtgatgaaaagcgatttgacaaaaatctcagcaaagccttgctgaaggtc
cgtgagtttggcggtgacggactatttacgagctggactcacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagccagaaggcgatgaaaggctatcattcaatg
atgctggatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgttgccgaagatatgacgcgcctgacgctggatacaatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagtatgctt
cgtgcgctgcaggaggcaatgcgccaatcacaaagacacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaattcgcttgtagaccgg
atcatcgctgagcggagggaaaatccggatgagaatctgtctgaccttttagcattgatg
cttgaagcgaaagaccctgtaacaggggaaaggctggatgatgaaaatatccgttatcaa
atcattacctttttgatcgctgggcatgaaaccacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattgaaaaaagccgttcaggaagccgagcgggtg
ctgacgggagagacccctgaatataagcagattcagcagctgacatatatccgcatggtg
ctaaatgagactttgcggctgtatccgactgccccggcattttctctgtacgcgaaggaa
gatacggttctcggcgggaaatatccgattgcgaagggacagccggtgacgattctgact
cctcagctgcaccgggataaaagcgcgtggggagaagatgccgagttattccgtccggaa
aggttcagcgatcccgcggcaattccggctgatgcgtataagccgttcggaaacggacag
cgcgcatgcatcgggatgcagtttgccctgcaggaagcgacaatggtgctcggccttgtc
ctgaaacattttgaactgattgatcatactgattatgagcttacgattaaagaagctcta
accattaagcccggtgattttaaaatccgtgtgaaaaacaaggacgtgtccaatcatcag
cccgtgcaaaaccataaagctgaaggaagcggtcacaaagaagaaacgaaagaaatcccg
tcccacggaacgccgcttctcattctttacggatcaaatttaggaactgcggaaggaatc
gcggaagagctggctgatatcggaagaagcaaaggattttcaactgaaagcggcccgctc
gatgattatgccgggaaactgcctgtaaaaggcgcagtcgttattgttacggcttcttat
aacggggcgcctcctgataatgcggcgggttttgtgaaatggatggaaacccttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaactgggccgcc
acttaccaaaggatcccccgcctgatagacaaagtgcttgaagaaaaaggggcaaaacgg
ctgacctctatcggggagggcgacaatgccgatgattttgagtacagtcaggaagcctgg
gaagactcattctggaaggacatcatgaaggcttttcatatagaggccgctccaaaacag
acaaacaaatcacagttatcaatcgaatacgtaagtgaagcagccgagacgccgattgcc
aaaacgtacaaagcatttgaggcggaggtcatcacgaacaaagagcttcataccgaaagc
agcaagcgctcagtccggcatattgagctgcgtctccccgaaacagaaacgtatcaggaa
ggagatcatctcggggtgcttccgcaaaacagcggggaactgatcagccgtgtcattcgc
cgattcggtcttgatccgaaccagcactttaagatcaagggccggcagctgcctcatctg
ccgatggaccggccggttaatgcgccggagcttttggcgtcctatgtagagctgcaggag
ccggcaacgagagcccagcttcgcgaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgatgcggcatataaagaaaacgtgctgaaaaac
cgaatgaccatgctggacctgctggaagattatcctgcatgtgaactgccgtttgagcgc
tttttagaacttctgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaccagcggggagctcagtatcacggtcggcgttgtgacggctccggcatggagcggc
cgtggggaataccggggcgtggcttcgaactatttagccggattacaaaaaggcgattct
gccgtctgtttcatccgctcgccgcagtcgggtttcgcattgcctgaaaatccgaaaacg
cctctcattatggtcggagcaggcacaggaattgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtctggtaacagcctgggcgaagctcatttatacttcggctgc
cggcatcctgaacaagacgatctgtacaaagatgaattcgaccatgcggagaaaaacggc
cttgtcaccgtgcatcgggcgtattccaggttagatcaggactgtaaagtatatgtacag
gatgttctgcttcgcgaggctgcacaaattattgcccttcttgaccaaggcggccatctc
tatatatgcggtgacggaagcaaaatggctccggctgtcgaaaatgtactgcttcaggcg
tatgaaaaggtgcataacactgattcaaaagtttccttgaattggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtttgggcaggtatgtaa

DBGET integrated database retrieval system