KEGG   Bacillus amyloliquefaciens FZB42: RBAM_024590Help
Entry
RBAM_024590       CDS       T00582                                 

Gene name
yrrC
Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bay03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2576942..2579320)
Genome map
AA seq 792 aa AA seqDB search
MDQLNIEEQPYVKGVIHTVIYHNDTNLYTVLKVKVAETSEAIEDKVVSVTGYFPLLQEDE
TYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIHYLSSDLFEGIGKKTAEEIVKKLGD
GALNKILTDASVLYDVPKMSKKKADKLAGELQRHQGLEQIMISLNQYGFGPQLSMKIYQA
YETETLEKIQENPYQLVKDVEGIGFVKADELGGKMGLSGNHPERIKAAILYTIESTCLSE
GHTYIETKQLIINTQTLLNQSAEGGRVTEMDAADGIIALGESKDIVIEGERCYFPSLFYA
EQNVAKRVLDIAAQTEYADQFPESEFLLALGELEERMNVQYAPSQKDAIQKALSSPMLLL
TGGPGTGKTTVIKGIVELYSELHGVSLDPGDYKKDEAFPVLLAAPTGRAAKRMSESTGLP
AVTIHRLLGWNGAEGFTYNEDQPIEGKLIIIDEASMLDIWLASHLFKALPKHIQLIVVGD
EDQLPSVGPGQVLRDLLASEVLPTVRLTDIYRQAEGSSIVELAHDMKKGLLPKGLTAPTK
DRSFIRCNSSQIKEVVDQVVSNALKKGYTSRDIQVLAPMYRGKAGINELNMLLQDIMNPP
KEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEIVSIFYAKENTEKEDMVVVSFD
GNEITFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITRAKKF
LILCGEEEALEWGVKNNDATVRQTSLKNRLTEQTEEMDAELAALQKELPFSVYDANIGME
GITPFDFMEEKA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagctgaacatcgaagaacagccgtatgtaaaaggcgtcattcatacggtcatt
tatcacaatgacaccaacctgtatacagtgctgaaagtcaaggttgcagaaacgtctgag
gcgatcgaagacaaggtcgtatccgtaacgggctacttccctctgctgcaagaagatgag
acctacacattttacggaaaaaccgccacgcatcctaagttcggcctgcaatttcaggct
gaacactttaaaaaagaaattccgaccacaaaagaagggatcattcactatttatcaagt
gatctgtttgaaggaatcggaaaaaaaacggcagaagaaatcgtcaaaaagctcggagac
ggcgcgctcaataaaattctgacggatgcgtcggtgctttacgatgtgccgaaaatgtcg
aaaaagaaagcggataagcttgccggagagctgcagcggcatcaggggcttgagcagatt
atgatctctctgaaccaatacggtttcgggccccagctatccatgaaaatatatcaggcc
tacgaaacggaaacactggagaaaattcaggaaaatccttatcagcttgtaaaagacgtt
gaaggcatcggctttgtgaaagctgacgagctgggcggaaaaatgggtctgtcaggaaac
cacccggagcggatcaaagcggcaatcttatatacgattgaatcgacctgtctttcagaa
ggccatacgtacatagagacaaagcagctgataatcaatacgcaaacgctcctgaatcag
tcagctgaaggcggccgcgtcacggaaatggatgcggctgacggcatcatcgccctcggg
gagagtaaggatatcgtcattgaaggagagcgctgctattttccgtccttgttttacgcc
gaacaaaatgtcgcaaaacgcgtgctcgacattgcggctcagacggagtatgccgatcaa
tttcctgaatcggaatttctgcttgcactcggtgaactggaagaacggatgaatgttcaa
tacgcaccaagccaaaaggatgccattcaaaaagcgctgtcttcaccgatgcttttactg
accggaggacctgggacggggaaaacgaccgttattaaaggaatcgtggaattatacagt
gaactgcacggagtatcgcttgaccccggtgattataaaaaagacgaggcgttcccggtg
ctgcttgccgcgccgacgggaagagccgcaaaacggatgagcgaatctacgggtctgccg
gctgttacgatacacaggctgctcggctggaatggcgctgaagggtttacctacaatgaa
gatcagccgatagaagggaaactgatcattatagacgaagcgagtatgctcgatatctgg
ctcgccagccatttgtttaaggcgcttcctaagcacattcagctcattgtcgtcggtgat
gaagaccagcttccttcagtaggaccggggcaggtgctcagagaccttttggcttctgag
gtactgccgaccgtgcgcctgacagatatttaccgtcaggctgaaggatcatccattgtg
gaacttgcgcatgatatgaaaaaaggactgcttccaaaggggctgaccgcgccgacaaag
gaccgctcatttatccgctgtaattcttcacagattaaagaagtcgtggatcaggtcgtc
tcgaacgcgttaaaaaaggggtatacctccagggatattcaagtgcttgccccgatgtac
aggggaaaagcgggaattaacgagctgaatatgcttcttcaagacatcatgaatccgccg
aaagaaaaaaggcgggagctgaaattcggtgatgtcgtctacaggacgggcgataaaata
ttacagcttgtcaaccagccggaaaacaatgtgtttaacggcgatatcggcgaaatcgta
tccattttttatgccaaagaaaatacggaaaaagaagacatggtcgtcgtctcgtttgac
ggcaacgaaatcacctttacgaaaaaggatttcagccagtttacccacgcttactgctgt
tccattcataagtcgcagggaagcgaattcccgattgtcgtcctgcctgtcgtcaaaggc
tactatcgaatgctcaggagaaatctgctttataccgccataacaagggcgaaaaaattt
ctgattctttgcggagaagaagaagcgcttgaatggggcgtcaaaaacaatgatgccacc
gtcagacagacgtcgcttaaaaacaggctcacagagcagactgaagagatggatgcagaa
ctggccgccctgcaaaaagagctgccgttcagtgtatatgatgcgaacatcggaatggaa
ggcatcacgccgtttgactttatggaagaaaaagcgtaa

DBGET integrated database retrieval system