KEGG   Bacillus amyloliquefaciens FZB42: RBAM_025200Help
Entry
RBAM_025200       CDS       T00582                                 

Gene name
hemD
Definition
hypothetical protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bay00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2639749..2640528)
Genome map
AA seq 259 aa AA seqDB search
MANDLPLQGKTVLVTRNKRQAAPFRKKVEALGGTAVSASLIAFQEALPDECADSLREDLS
EPGWLVFTSVNGVRFFFSYLDRHGLALSGRKKIAAVGEKTARALKERGARTDAMPDEYVA
ECLADTLKRYASAAEPISVIKGNLSRDVIKAELEPLGYQIREWVLYNTIQDEKGMDELRR
AASRSHFDFITFTSSSAVHTFMHAVGDGEKAWENSGASYISIGPLTEKALLEYGISSHVP
DTYTIEGMLDVMCSMSGKD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgaccttcctttacaaggaaagaccgtgctcgtcacccggaacaaaagacag
gccgcaccgttccgaaaaaaagtggaggcgctcggcggaacggctgtttccgcttcgctg
atcgcttttcaggaagcgctcccggatgaatgtgcggacagtctccgggaagacctttct
gagccgggatggcttgtgtttacaagcgtaaacggtgtccggttctttttttcctatctt
gatcgtcacggtcttgcgctttcgggacggaaaaaaatcgcagccgtcggtgaaaagact
gcgcgcgccctgaaagagcggggagcccggacggatgcgatgcctgacgagtatgtggcg
gaatgtctggctgatactttaaaacggtacgcatcagctgccgaacccatttcagtgata
aagggcaatttatcacgcgatgtcataaaagcggagcttgagccgcttggctatcaaata
agggaatgggtgttatacaataccattcaggatgaaaaaggcatggacgagctgagacgg
gctgcatcccgctctcattttgattttattacgtttaccagctcatcggcggtccatacg
tttatgcacgcggtcggagacggagaaaaagcgtgggaaaacagcggtgcgagctatatc
agcatcggccctttgacagagaaagcgctcttggaatacgggatctcatcccatgtgcct
gacacttatacgattgaaggcatgctggacgtcatgtgcagcatgtcgggaaaggattga

DBGET integrated database retrieval system