KEGG   Bacillus velezensis FZB42: RBAM_025600Help
Entry
RBAM_025600       CDS       T00582                                 

Gene name
ysiB
Definition
(GenBank) YsiB
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00071  Fatty acid degradation
bay00362  Benzoate degradation
bay01100  Metabolic pathways
bay01120  Microbial metabolism in diverse environments
bay01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    RBAM_025600 (ysiB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RBAM_025600 (ysiB)
Enzymes [BR:bay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RBAM_025600 (ysiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABS74918
UniProt: A7Z7E2
Position
complement(2680418..2681197)
Genome map
AA seq 259 aa AA seqDB search
MNSLSMAVEQSVAVITINHQPANALSGAVLDELSGLFDRCETDDSVRSIIIRGEGKFFSA
GADIKEFTSLEKLEQSSAMADKGQQLMERIEGFPKPVIAAIHGAALGGGLELAMACHIRI
ATLDAKLGLPELNLGIIPGFAGTQRLPRYVGTAKALEMIGTSEPVTGEEALSLGLVTVGA
EHEEELLKKAKTLAGKFAEKSPQSMASLLELLYSNKIYSYDGGLKLEAKRFGEAFASDDA
KEGIQAFLEKRKPQFGGRR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcctttcgatggcggtagaacaatctgttgcggtgatcaccattaatcatcag
ccggccaacgcgctgtccggtgcggttttagacgagttgtccggtctgttcgaccgatgt
gaaacagatgacagcgtcagaagcatcatcattcgcggtgaggggaaatttttctcggcg
ggcgccgatataaaggaatttacgtcgcttgaaaaacttgagcaatcttctgccatggcg
gataaaggccagcagctgatggaaagaattgaagggtttccgaagcccgttatcgcagcg
attcacggcgctgcgctcggaggcggtcttgagctagccatggcctgccatatcagaatc
gctacattagatgcaaagctcggcctgcccgagctgaatctcggcattattccgggcttt
gccgggacgcagcggcttccccggtacgtcggtacggcgaaagcgcttgaaatgatcggc
acttcagaacctgtgaccggagaagaagcgctcagcctcggtcttgtcacggtaggcgcc
gaacatgaggaagagctgctgaaaaaggcgaaaacgctcgcgggcaagtttgcggaaaaa
agcccgcagtcgatggcttctctgcttgagctcctttattcaaacaagatctattcttat
gacggcggcttaaagcttgaagcaaagcgttttggggaagcatttgcatcagatgacgca
aaagaaggcattcaggcatttctcgaaaaaagaaagcctcaattcggtgggcgaagataa

DBGET integrated database retrieval system