KEGG   Bacillus velezensis FZB42: RBAM_025880Help
Entry
RBAM_025880       CDS       T00582                                 

Gene name
ysdC
Definition
(GenBank) YsdC
Organism
bay  Bacillus velezensis FZB42
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2713678..2714763)
Genome map
AA seq 361 aa AA seqDB search
MTKLDETLTMLKALTDAKGIPGNEREVRQVMKSYIEPFADDVTTDRLGSLIAKKTGKENG
PKIMISGHLDEVGFMVTQITDKGFLRFQTVGGWWSQVMLAQRVTVVTKKGDITGIIGSKP
PHILPPDARKKAADIKEMFIDIGASSREEAMEWGVLPGDQIVPYFEFTVMNNEKHLLAKA
WDNRIGCAIAIDVLKNLKNSDHPNEVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGI
AGDTPGISEKEAQSKIGEGPQIILYDASMVSHKGLRDLVVNTAEEAGIPYQFDSIAGGGT
DSGSIHLTANGVPALSITIATRYIHTHAAILHRDDYENTVKLITEVIKKLDRETVDRITY
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaattagatgaaacgctcaccatgctgaaagcgttaacggatgcaaaagggata
ccgggaaatgagagagaagtaagacaagtgatgaaatcatacatagaaccatttgccgat
gatgtcacaacagaccggctgggaagcttaatcgccaaaaaaacgggcaaagaaaacggt
ccgaaaatcatgatctcagggcatttagatgaagtcggttttatggtgacgcaaatcact
gataaaggctttctccgctttcaaaccgtcggcggctggtggtctcaggtcatgctggcc
cagcgcgtcaccgtcgtgacaaaaaaaggggacatcacggggatcatcggttcgaaaccg
cctcacattctgcctcctgacgccagaaaaaaagccgccgatattaaagagatgttcatc
gatatcggggcgtccagccgtgaagaagcaatggaatggggcgttcttccgggtgaccag
attgtgccgtattttgaatttacagtgatgaacaatgaaaaacatttattggcgaaggca
tgggacaaccgtatcggctgcgcgattgccatcgatgtattaaaaaatctgaaaaacagc
gatcatccgaatgaagtatacggggtcggaacggttcaggaagaagtcgggcttcgcggg
gcgaaaacagcggcacatacgattcagcctgatatcgcgttcggtgtggatgtcggaatt
gccggagatacaccgggaatttctgaaaaagaggcgcaaagcaaaatcggcgaagggccg
caaattattctgtatgacgcgtcaatggtatctcacaaagggctgcgtgaccttgtcgtg
aacacggcggaagaagcgggaattccgtatcaattcgattccattgccggagggggcacg
gattcaggttccattcacttaaccgcaaacggagtgccggcgctgtccattacgatcgcg
acgcgctacattcatactcatgccgctattttgcatcgggatgattatgagaatacggta
aaattgatcacagaagtgattaaaaaattagatcgggaaacggttgaccgtattacttat
caataa

DBGET integrated database retrieval system