KEGG   Bacillus amyloliquefaciens FZB42: RBAM_026240Help
Entry
RBAM_026240       CDS       T00582                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RBAM_026240 (pfkA)
   01230 Biosynthesis of amino acids
    RBAM_026240 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_026240 (pfkA)
   00030 Pentose phosphate pathway
    RBAM_026240 (pfkA)
   00051 Fructose and mannose metabolism
    RBAM_026240 (pfkA)
   00052 Galactose metabolism
    RBAM_026240 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    RBAM_026240 (pfkA)
Enzymes [BR:bay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     RBAM_026240 (pfkA)
Protein phosphatases and associated proteins [BR:bay01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     RBAM_026240 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2750517..2751476)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYSGLISGKIEKLELGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWA
GLAGGAESILIPEADYDMQEIIGRLKRGHDRGKKHSIIIVAEGVGSGVEFGKRIEEETNL
ETRVSVLGHIQRGGSPSASDRVLASRLGAYAVELLLKGKGGRCVGIQNNKLVDHDIIEIL
ESKHTVEPNMYQLSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacgagcggcggggattccccgggtatgaacgctgcggtg
cgcgcggttgtgcggaaagctatctaccacgacgtcgaagtgtacggaatttataacggt
tattcaggattaatcagcggaaaaatagagaaactggagcttggttcggtcggtgacatc
atccaccgcggcggaacaaagctgtatacggccagatgtcctgaattcaaaacagttgaa
ggccgtgaaaaaggaatcgaaaatttaaagaaactcggcattgaaggtcttgtcgtcatc
ggcggagacggttcatacatgggtgcgaaaaaattaacggaacacgggtttccgtgtgta
ggtgtaccgggtacgatagataatgacatcccgggaactgattttacgatcggatttgat
acggcgttaaacaccgtaattgatgcgattgataaaatccgtgacaccgctacgtctcat
gagcgtacatacgttattgaagtgatggggcgccatgcgggcgacattgctttatgggca
ggtcttgcaggcggagcggaatcaattttaattcctgaagcggactacgatatgcaggaa
attatcggccgtttgaagagagggcacgaccgcggcaaaaaacacagtatcatcatcgtt
gcagaaggggtaggcagcggggttgaattcggaaaacgcatcgaagaagaaacgaacctt
gaaacacgggtatccgttttagggcacatccagcgcggcggatctccaagcgcttctgac
cgggttcttgcaagccgcctcggcgcttacgcggttgagcttctgcttaaaggaaaaggc
ggacgctgcgtaggtatacaaaacaacaagcttgtagaccatgatattatagaaatttta
gaatcaaaacatactgttgaaccaaacatgtatcagctttcaaaagaactgtctatttaa

DBGET integrated database retrieval system