KEGG   Bacillus amyloliquefaciens FZB42: RBAM_027080Help
Entry
RBAM_027080       CDS       T00582                                 

Gene name
ytjP
Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bay01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bay00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2832481..2833872)
Genome map
AA seq 463 aa AA seqDB search
MNWEVEVIRNKEDLIRDTQKFLQINSVMDESTAGPGRPFGEGVNASLTSLLEFGEKEGFT
VKNLDGYAGHIEWGTGDEIVGVLCHVDVVPPGDGWTSDPFSADIRDGRIYARGAIDDKGP
TMAAFYALKIVKDMQLPLSKRVRIIIGTDEESDWRCVDHYFKHEKMPDIGFAPDADFPII
NAEKGIIDASLRIAQSASDKDAKNGLLSFRSGLRLNMVPDAAEAVIEGDGLDAVHAYFSK
WLEQSKTQGEAVSENGKLTLRVYGKSCHAMEPDNGVNAGLKLAECLNGTELDGAGKHFVK
TVSDYFLNDTRGKKLKIDCRDDISGELTLNVGTFTYRKGEEGELGINIRYPVTSDSNVIR
DAFTSAEEFRLEEFKDSKPHHVSADHPLVKTLQKVYEGQTGKKADLISIGGGTYARSLSA
GVAFGPLFPGRPDSAHQKDEYIEIDDLLRSTALYAEAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagttgaagtcatcagaaacaaagaagatctgatccgtgacacgcagaag
tttttgcagatcaacagcgtaatggacgaatcaacagccggtcccggccggccgtttgga
gaaggcgtcaatgccagcctgacgtcactgctggaattcggtgaaaaagaaggcttcacc
gtaaagaatcttgatggctatgcgggccatattgaatggggaacgggtgacgaaatcgtc
ggcgttctgtgccacgtcgatgtcgttccgcccggagacggctggacgagcgatccgttt
tcagccgatatcagggacggccggatatatgccagaggcgccattgatgataaagggccg
acaatggcggcgttttatgcgctgaaaatcgtcaaagacatgcagcttcctttatccaaa
cgcgtgagaatcatcatcggaacggatgaagaaagtgattggagatgcgtggatcactac
ttcaaacacgaaaaaatgcctgacatcggctttgctcctgacgcggattttccgatcatt
aacgcggaaaaaggaattatagatgcgtcactgcgcattgcacaaagcgcttctgacaaa
gacgcaaaaaacgggcttctgtcattccgttcaggacttcgcttgaacatggtgccggat
gcggctgaagcggttattgaaggggacggtcttgatgccgtgcacgcatatttcagcaaa
tggcttgagcagtcaaaaacacaaggtgaagcagtttcggaaaatggaaaactgacgctt
cgggtatacggaaaatcatgccacgcgatggaaccggataatggtgtcaatgccggctta
aagcttgctgaatgccttaacggaacggagctggatggagccggaaagcactttgtcaaa
accgtcagtgactattttttaaatgatacacgaggcaaaaagctgaaaattgattgcagg
gatgacatcagcggagagcttacattgaatgtcggcacctttacatacagaaagggtgag
gaaggagaactcggcatcaacatccgttatcccgtcacttcagacagcaatgtcatccgt
gatgcttttacgtctgctgaagaattccggcttgaagaatttaaagacagcaaaccgcac
cacgtttctgccgatcatccgctcgtaaagacgcttcaaaaggtttacgaaggacagacg
ggaaagaaagcggatctgatttcaatcggcggaggaacgtatgcgagatccctttcggcg
ggcgtcgcgttcgggccgctgttccccggccggcctgacagcgcgcatcaaaaggatgag
tacattgaaatcgatgaccttctccggtcaaccgctttatacgccgaagccatttatgag
cttgccaagtga

DBGET integrated database retrieval system