KEGG   Bacillus amyloliquefaciens FZB42: RBAM_027220Help
Entry
RBAM_027220       CDS       T00582                                 

Gene name
melA
Definition
MelA (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bay00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bay00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bay00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2847914..2849212
Genome map
AA seq 432 aa AA seqDB search
MKKITFIGAGSTIFAKNVLGDCLLTEALNGFEFALYDIDAVRLKESQLMLENMRDRYNTS
ISIISYDDRKQALKHAGYVINAIQVGGYKPATVIDFDIPKRYGLRQTIADTVGIGGIFRS
LRTIPVLFDIAKDMEEVCPDAWLLNYTNPMASLTGAMLRHTNVKTVGLCHSVQVCTKDLF
DSLGMDHEGTEERIAGINHMAWLLEIKKDGIDLYPEIKRRAREKQKTKHKDMVRFELMDK
FGCYVTESSEHNAEYHPYFIKSRYPELIDELQIPLDEYPRRCAEQINNWETMRDGIINNQ
NLTHKRSKEYGSRIIEAMETGKPFTFGGNVLNTGLIPNLPAKAVVEVPCTAVKNHIMPCY
SGELPEQLAALNRTNINTQLLTIEAAVTLKKEAVYQAAMLDPHTSAELSMNDIISLCDDL
FEAHKDRLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaaattacatttatcggagcgggaagcacgattttcgcaaaaaatgtattgggg
gactgcttactgactgaagcattaaacgggtttgaattcgcgctttatgatattgacgct
gtacggctgaaagaatcccagctcatgctggaaaacatgagagaccgctacaatacgagt
atatccatcatctcctacgatgaccgaaaacaggcgctgaaacacgccggctatgtgata
aacgccattcaggtcggaggctataaacccgcgacggtcattgactttgacatcccgaag
cggtacggtctccgccagacgattgccgataccgtcggaataggcggcattttccgttcc
cttcgcaccatccccgttttatttgatatcgcaaaagacatggaagaggtctgcccggat
gcgtggctgttaaactatacaaatccgatggcctctctgaccggagcgatgctcagacat
acaaatgtcaaaacggtcggcctgtgccacagcgtccaggtatgtaccaaagatctgttt
gactcactcggcatggatcacgaaggtacggaagaacgcattgccggcattaaccatatg
gcttggcttttggagattaaaaaagacggaattgatttatatcctgaaattaaaagacgg
gcacgcgaaaaacaaaagacgaaacataaggacatggtgcggtttgagctgatggataaa
ttcggctgctacgtaacggaatcatctgagcataatgccgaatatcacccgtattttata
aaaagccggtatcctgagctgatagatgaactccaaattccgcttgatgaatatccgagg
agatgcgcggaacaaatcaacaattgggaaacgatgagagacggcatcatcaacaaccaa
aacctgacgcataaacgctcaaaagaatacggttcgagaattattgaagcgatggagacg
ggcaaaccgttcacattcggcggcaatgtgctgaataccgggctgataccgaatctgccg
gcgaaagcggtcgttgaagtgccttgcacagccgtcaaaaaccacattatgccgtgctat
tcgggcgaacttcccgagcagctcgcggcgctcaacagaacaaacattaacacacagctt
ttaaccatcgaagcggccgttacattaaaaaaggaagctgtatatcaggcggccatgctt
gatccgcatacgagcgccgagctttccatgaatgacatcatatctttgtgcgatgactta
tttgaagcgcacaaagaccggcttccggcttatcactga

DBGET integrated database retrieval system