KEGG   Bacillus amyloliquefaciens FZB42: RBAM_027530Help
Entry
RBAM_027530       CDS       T00582                                 

Gene name
ytpA
Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RBAM_027530 (ytpA)
Enzymes [BR:bay01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     RBAM_027530 (ytpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2891844..2892623)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPERETVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcattatccacggggcaagc
gaataccacggacgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggcgatttgcccggtcagggaacgtcgacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgataaagcgagaacgcttgaagcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtctgggtctgcaaata
aaagtcaataaagtccttgattttgcgtctaaaggactgaacgtcctcgctccgtccctc
agagtggattccggcttatcacctgatatggcaacgaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaggtatccgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaggtgccgcttttgctt
atgcagggcggagatgacaaaatcgtcgataaaatgaaggtccgcaaatggttttccggt
gtggcttcccataataaatcgtaccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaaactgtgtttaaggcggcaaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system