KEGG   Bacillus amyloliquefaciens FZB42: RBAM_027530Help
Entry
RBAM_027530       CDS       T00582                                 

Gene name
ytpA
Definition
hypothetical protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bay00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2891844..2892623)
Genome map
AA seq 259 aa AA seqDB search
MWTWKADRPVGTIVIIHGASEYHGRYKWLVEMWRSSGYNVVMGDLPGQGTSTRARGHIRS
FQEYIDEVDIWIDKARTLEAPVFLLGHSMGGLIAIEWFKQQRNPRITALILSSPCLGLQI
KVNKVLDFASKGLNVLAPSLRVDSGLSPDMATRNADMIEADQNDSLYVTKVSVRWYRELL
KTIDAAMVPTDAFLKVPLLLMQGGDDKIVDKMKVRKWFSGVASHNKSYREWEGLYHEIFN
EPERETVFKAAKAFTDQYI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtggacttggaaagcagacaggcccgtcggtaccattgtcattatccacggggcaagc
gaataccacggacgttataaatggctcgttgaaatgtggagatcttccggatataacgtg
gtgatgggcgatttgcccggtcagggaacgtcgacccgcgccagagggcatattcgctct
ttccaagaatacattgatgaagtagatatatggattgataaagcgagaacgcttgaagcg
cccgttttccttttgggccacagcatgggcggactgattgcgatagaatggtttaagcag
cagagaaatccccgcattacggcactcattttatcatcaccttgtctgggtctgcaaata
aaagtcaataaagtccttgattttgcgtctaaaggactgaacgtcctcgctccgtccctc
agagtggattccggcttatcacctgatatggcaacgaggaatgcggatatgattgaagcg
gatcaaaacgattctttatatgtcacgaaggtatccgtaagatggtacagagagctttta
aaaaccattgatgccgctatggtgccgactgatgcgtttttaaaggtgccgcttttgctt
atgcagggcggagatgacaaaatcgtcgataaaatgaaggtccgcaaatggttttccggt
gtggcttcccataataaatcgtaccgggaatgggaagggctttatcatgaaatttttaat
gaaccggaaagagaaactgtgtttaaggcggcaaaagcctttacagatcagtatatttga

DBGET integrated database retrieval system