KEGG   Bacillus velezensis FZB42: RBAM_029360Help
Entry
RBAM_029360       CDS       T00582                                 

Gene name
thrC
Definition
(GenBank) ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00260  Glycine, serine and threonine metabolism
bay00750  Vitamin B6 metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01230  Biosynthesis of amino acids
Module
bay_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    RBAM_029360 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    RBAM_029360 (thrC)
Enzymes [BR:bay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     RBAM_029360 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABS75267
UniProt: A7Z8E1
Position
complement(3058921..3059979)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEKLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARAGMKCIVIIPDGKIAFGKLAQAVM
YGAEIIAIDGNFDDALAIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDIL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGSAAIVRGEVIKNPETVATAIRI
GNPASWDKAVLAAEESAGKIDEVTDEDILHAYQLIAREEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDVSDIKPITLPTDEDSILEYLNGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggactcatccatcaatataaagaatttctgccggtgacggatcagacgccg
gccctgacattgcatgaaggcaacacgccgctgattcacctgccgaaactttccgaaaag
ctcggaattgaactgcatgtgaaaacagagggcgttaatccgacgggatcctttaaagac
cgcggcatggtcatggcggtcgccaaagcgaaagaagaaggcaatgataccatcatgtgc
gcctctacagggaacacatccgcggcagctgcggcatacgcggcgagagccggcatgaaa
tgcatcgtcatcatcccggacggaaaaatcgccttcggaaaacttgcgcaggccgtcatg
tacggtgcggaaatcatcgcgattgacggaaactttgacgacgcgctggccatcgtccgg
tcgatttgcgaaaaatcaccgattgcattagtgaattcagtaaacccttaccggattgaa
gggcaaaaaacagcggcctttgaagtatgcgaacagctcggcgaagcgccggacattctg
gcgatcccggtaggaaacgccgggaatatcacggcctactggaaagggttcaaagaatac
catgagaaaaacggcaccggacttccgaagatgcgcggttttgaggcggaaggttctgcg
gctatcgtccgcggcgaagtcattaaaaatccagagaccgttgcgacggcaatccgaatc
gggaatcctgccagctgggacaaagcggtgctcgctgcggaagaatcagccggaaaaatt
gatgaagtcacagatgaagacattcttcacgcttatcagctgattgcccgtgaagaaggc
gtgtttgccgaaccgggctcctgtgcatccatcgccggcgttttgaaacaggtaaaatcc
ggtgaaattccaaaaggcagcaaagttgtcgcagttttgaccggaaacggcctgaaagat
ccgaacacggctgtagacgtatctgacataaaaccgattacgctgccgacagatgaggac
agtattctggaatacttaaatggagcggcgcgtgtatga

DBGET integrated database retrieval system