KEGG   Bacillus velezensis FZB42: RBAM_031280Help
Entry
RBAM_031280       CDS       T00582                                 

Gene name
tpiA
Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00010  Glycolysis / Gluconeogenesis
bay00051  Fructose and mannose metabolism
bay00562  Inositol phosphate metabolism
bay01100  Metabolic pathways
bay01110  Biosynthesis of secondary metabolites
bay01120  Microbial metabolism in diverse environments
bay01130  Biosynthesis of antibiotics
bay01200  Carbon metabolism
bay01230  Biosynthesis of amino acids
Module
bay_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bay_M00002  Glycolysis, core module involving three-carbon compounds
bay_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RBAM_031280 (tpiA)
   00051 Fructose and mannose metabolism
    RBAM_031280 (tpiA)
   00562 Inositol phosphate metabolism
    RBAM_031280 (tpiA)
Enzymes [BR:bay01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     RBAM_031280 (tpiA)
Exosome [BR:bay04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   RBAM_031280 (tpiA)
  Exosomal proteins of bladder cancer cells
   RBAM_031280 (tpiA)
  Exosomal proteins of melanoma cells
   RBAM_031280 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS75459
UniProt: A7Z8Y3
Position
complement(3241271..3242032)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEENGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKVVAESFSQETADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatagccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagcggaagccgttgtt
tgcgcaccagctcttttcttagaaaagctgacttctgctgttaaaggaactgacctgaaa
gtcggcgcccaaaacatgcattttgaagaaaacggtgcgttcacaggtgaaatcagcccg
gtcgctctgaaagaccttggcgtggattactgcgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcgcatgccgctttcaaacacggc
attgtgccgatcatttgcgtaggtgaaacgcttgaagagcgcgaagccggaaaaacaaat
gatcttgttgccgatcaagtgaaaaaaggtcttgcgggtctttctgaagagcaagttgct
gcttctgttattgcgtacgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgctaacgacgtctgcgcgcatatccgtaaagtcgttgctgaaagcttcagccag
gaaactgctgacaagctccgcattcaatacggcggcagcgtaaaacctgcaaatattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcaagccttgaaccg
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system