KEGG   Bacillus amyloliquefaciens FZB42: RBAM_033090Help
Entry
RBAM_033090       CDS       T00582                                 

Gene name
rbsK
Definition
hypothetical protein (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RBAM_033090 (rbsK)
Enzymes [BR:bay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RBAM_033090 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3433170..3434051
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSERRPKAGETVLGTDFQTVPGGKGANQAVAASRLGANVYMVGK
AGNDSYGKAIIENLKANGVNTDHMETVTHKKSGTAHIVLAEGDNSIVVVKGANDDISPDY
AKSALAKLPGIDIVLIQQEIPEETVEEVCSYCRAQQIPVILNPAPARPLKQSTIEDAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLIPAFPAEAVDTTGA
GDTFNAALAVALAEGRDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatttgtgttatcggaagctgttctatggatctggtcgtcacatctgaacgg
cgtccgaaagccggtgaaaccgtactgggcacagactttcaaaccgtgcccggaggaaaa
ggcgcaaatcaggccgtagccgcttcccgcctgggcgcaaacgtatatatggtaggaaaa
gcaggcaatgacagctacggaaaagcgattattgaaaacctgaaggcaaacggtgtcaat
acggaccatatggaaacggttacacataaaaaaagcggaacggctcatattgtgctcgca
gaaggagacaacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcccccgattat
gccaaaagtgcgctagcaaaacttcccggcattgatatcgtgctgatccagcaggagatt
cctgaagaaaccgttgaagaagtgtgcagctactgccgcgcgcagcaaattccggttatc
ctgaatcccgcgccggcccggccgctgaaacaatcgacgattgaggatgccgcatatctt
acgccgaacgaacatgaagcgtccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaactgttcattaccgaaggaaaacaaggcgtgcgctactcagac
ggcaccgccgaacggcttattcccgccttccctgcagaagcggtcgacacgacaggagcc
ggcgatacctttaatgcagcacttgccgtcgcactcgcggaagggcgggacattgagcaa
gcgctcctgtttgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
ggcatgccggccagaaaagaagttgaggagctgctgtcatga

DBGET integrated database retrieval system