KEGG   Bacillus amyloliquefaciens FZB42: RBAM_035060Help
Entry
RBAM_035060       CDS       T00582                                 

Gene name
spsL
Definition
SpsL
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    RBAM_035060 (spsL)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RBAM_035060 (spsL)
Enzymes [BR:bay01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     RBAM_035060 (spsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3613860..3614321)
Genome map
AA seq 153 aa AA seqDB search
MQVIEGVKVKKLIKHSDDRGFFSELVRDDEHLLERFGQASWSKSYPGVIKAFHYHEKQDD
LWFFPTGHAQVVLHDLREESATKGETDVYYMGEDNPMLLLIPKGVAHGYRVLGETPLTII
YFTTMSYNPDQPDEKRIPWNDDTIGFDWQTAHR
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtgatcgaaggcgtaaaagtcaaaaagctgatcaaacacagcgatgaccggggt
tttttctcagaactcgtccgtgacgatgaacatctcttagagcgtttcgggcaggcttcc
tggtccaaaagctatcccggcgtcattaaagcatttcactatcatgagaaacaggatgac
ctatggttttttccgacgggccacgcccaggtcgtgctgcatgaccttcgcgaagagtct
gcaaccaagggagaaacggatgtctactacatgggagaagacaatccgatgctccttctc
attcccaaaggcgtcgcacacgggtacagagtgctgggcgaaaccccgctgaccattatt
tatttcacgacaatgtcctacaatccggatcagcctgacgaaaaaagaatcccgtggaat
gatgacaccatcggatttgactggcagacggctcaccgatag

DBGET integrated database retrieval system