KEGG   Bacillus amyloliquefaciens FZB42: RBAM_037230Help
Entry
RBAM_037230       CDS       T00582                                 

Gene name
rocF
Definition
RocF (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bay01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bay00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3831478..3832368)
Genome map
AA seq 296 aa AA seqDB search
MNKNISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYAVEDLGDIPVNREKLKND
EELKNLNSVLSGNEQLAQKVDSVIENERFPLVLGGDHSIAIGTLTGTAKHYKQLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGVGHDTLVNLGGYAPKIKPENVVIIGARSLDEGER
EYIKETGMKVYTMHEIDRLGMTKVIEETIDYLSDCDGVHLSLDLDGLDPSDAPGVGTPVV
GGISYRESHLAMEMLYDADIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaatatctcagttattggaatgccgatggatttaggacaagcacgacgcgga
gtggacatgggcccgagcgccatccgttacgcgcatctcattgaacggttatctgacatg
gggtatgcggtggaagacttaggcgacatccccgtcaatcgtgaaaaactcaaaaatgat
gaagagctgaaaaatctgaactctgtgctctcggggaacgagcagctcgcccaaaaggtg
gacagcgtcattgagaatgagcggttccctctcgtcttgggcggcgatcacagcatcgcg
atcggaacgctgacaggaacggcaaagcactataaacagctcggcgtcatctggtacgac
gcgcacggcgacttaaacacgctggaaacatcgccgtcaggcaatattcacggaatgccg
ctggccgtcagcctcggcgtcgggcacgacacgctggtgaatctgggcgggtatgccccg
aaaatcaagccggagaacgtcgtcatcatcggcgcgagatcgcttgatgaaggcgagcgt
gagtacattaaggaaacaggcatgaaggtctatacgatgcatgagattgaccgcctcggc
atgacaaaggtcattgaagaaaccattgactacttgtcagactgtgacggcgttcacctc
agccttgacctcgacggccttgatccgagcgacgcgcccggcgtaggcacgcctgtcgtc
ggcggcatcagctaccgtgaaagccatttggcaatggaaatgctgtatgatgccgacatc
atcacttcagctgaatttgtcgaagtcaacccgatcctcgatcacaaaaacaaaaccggc
aaaacagcggtcgagctggtggaatctttgttaggaaaaaaactgttataa

DBGET integrated database retrieval system