KEGG   Bacillus velezensis FZB42: RBAM_037840Help
Entry
RBAM_037840       CDS       T00582                                 

Gene name
yxjF1
Definition
(GenBank) YxjF1
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bay  Bacillus velezensis FZB42
Pathway
bay00072  Synthesis and degradation of ketone bodies
bay00650  Butanoate metabolism
bay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bay00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RBAM_037840 (yxjF1)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RBAM_037840 (yxjF1)
Enzymes [BR:bay01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RBAM_037840 (yxjF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Epimerase 3HCDH_N Methyltransf_25 Methyltransf_31 DUF4406 TrkA_N NAD_binding_7 Methyltransf_23 Ubie_methyltran SmaI Sacchrp_dh_NADP RmlD_sub_bind MTS
Motif
Other DBs
NCBI-ProteinID: ABS76109
UniProt: A7ZAT3
Position
3887714..3888520
Genome map
AA seq 268 aa AA seqDB search
MNPGGVTMSKLLESKVALVTGAASGIGLEIAREFAKEGAKVVISDLNEKAVQHAAEELTE
QGYEVLSAVCDVTNEEQVEKSVSKTLETYGRLDILVNNAGIQHVSDIENFPTDKFEFMLK
LMLTAPFSATKRVFPLMKKQKFGRIINMASINGLIGFAGKAAYCSAKHGLIGLTKVSALE
GAEYGITVNALCPGYIDTPLVQNQLKDIAETRGISKEKVFEEVIYPLVPQKRLLAVQEIA
DYAVFLASDKAKGVTGQAVVMDGGYTAQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctggaggggttactatgagtaaattattggaaagtaaagttgctcttgttaca
ggcgcggcgagtggaattggtttagaaattgcacgtgaattcgctaaagaaggcgcaaaa
gttgtgatttccgatttgaacgaaaaagccgtgcaacatgcagctgaggaacttacggaa
caaggatacgaagtcctctctgcggtttgtgatgtaacaaacgaagaacaagtagaaaaa
agtgtctctaagacacttgaaacctatggacgattggatattctggtaaacaatgcgggg
attcagcatgtgtcggatatagaaaacttcccgactgataagtttgaatttatgctgaaa
ttaatgcttactgctccttttagtgcgacaaaaagagtattccctttgatgaaaaaacaa
aaatttggccgcatcatcaatatggcttccataaatggtttaatcggttttgcagggaaa
gcggcttattgcagcgccaaacacggtttgatcggtttaactaaagtatcagcattggaa
ggagcggaatacggaattaccgtcaacgccttgtgtccgggatatatcgacactccattg
gtgcaaaaccagttaaaagatattgcagagactagaggcatttctaaagaaaaggtgttt
gaagaagtcatttaccccttggttcctcaaaaacgtttgttagccgtgcaagaaatcgct
gattacgcagtattcctcgccagtgacaaagcgaaaggcgttacagggcaggcagtcgta
atggacggcggttatacggcccaatga

DBGET integrated database retrieval system