KEGG   Bacillus amyloliquefaciens FZB42: RBAM_037840Help
Entry
RBAM_037840       CDS       T00582                                 

Gene name
yxjF1
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bay  Bacillus amyloliquefaciens FZB42
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bay00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bay00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3887714..3888520
Genome map
AA seq 268 aa AA seqDB search
MNPGGVTMSKLLESKVALVTGAASGIGLEIAREFAKEGAKVVISDLNEKAVQHAAEELTE
QGYEVLSAVCDVTNEEQVEKSVSKTLETYGRLDILVNNAGIQHVSDIENFPTDKFEFMLK
LMLTAPFSATKRVFPLMKKQKFGRIINMASINGLIGFAGKAAYCSAKHGLIGLTKVSALE
GAEYGITVNALCPGYIDTPLVQNQLKDIAETRGISKEKVFEEVIYPLVPQKRLLAVQEIA
DYAVFLASDKAKGVTGQAVVMDGGYTAQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctggaggggttactatgagtaaattattggaaagtaaagttgctcttgttaca
ggcgcggcgagtggaattggtttagaaattgcacgtgaattcgctaaagaaggcgcaaaa
gttgtgatttccgatttgaacgaaaaagccgtgcaacatgcagctgaggaacttacggaa
caaggatacgaagtcctctctgcggtttgtgatgtaacaaacgaagaacaagtagaaaaa
agtgtctctaagacacttgaaacctatggacgattggatattctggtaaacaatgcgggg
attcagcatgtgtcggatatagaaaacttcccgactgataagtttgaatttatgctgaaa
ttaatgcttactgctccttttagtgcgacaaaaagagtattccctttgatgaaaaaacaa
aaatttggccgcatcatcaatatggcttccataaatggtttaatcggttttgcagggaaa
gcggcttattgcagcgccaaacacggtttgatcggtttaactaaagtatcagcattggaa
ggagcggaatacggaattaccgtcaacgccttgtgtccgggatatatcgacactccattg
gtgcaaaaccagttaaaagatattgcagagactagaggcatttctaaagaaaaggtgttt
gaagaagtcatttaccccttggttcctcaaaaacgtttgttagccgtgcaagaaatcgct
gattacgcagtattcctcgccagtgacaaagcgaaaggcgttacagggcaggcagtcgta
atggacggcggttatacggcccaatga

DBGET integrated database retrieval system