KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_00070Help
Entry
BAMTA208_00070    CDS       T01824                                 

Gene name
dck
Definition
deoxyadenosine/deoxycytidine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:baz00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:baz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(18906..19559)
Genome map
AA seq 217 aa AA seqDB search
MKDIHIPNNAIITVAGTVGVGKSTLTKALAKRLGFNTSLEEVDENPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNMFESGGGFVQDRSIYEDTGIFAKMHADKGTMSLTDYKTYTSLFE
AMVMTPYFPHPDVLIYLEGDLENIIERIEKRGREMELQTNRAYWEEMYTRYEDWISGFNA
CPVLKVRIEDYDLEADEQSLEPLIEKISHVINENRKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatattcacattccaaacaacgccattataacagtagcgggaacggtaggagtc
ggaaaatcgactttaaccaaagctttagcaaaacgcctcgggtttaatacctcacttgaa
gaagtggatgaaaacccttatttagagaagttttatcatgactttgaacgctggagcttt
catttgcaaatttattttctggccgagcggttcaaggagcagaaaaacatgtttgaatca
ggcggaggattcgtgcaggaccgttcgatttatgaagatacaggcatattcgcaaaaatg
catgccgataaaggaaccatgtcgctgacagattacaaaacatacacaagcctttttgag
gccatggtcatgacgccatacttcccgcatcctgatgttttgatctatttagaaggcgat
cttgaaaacattatagagcggattgaaaagcggggccgtgagatggagctgcagaccaac
cgtgcctattgggaagagatgtatacgcggtacgaggactggatcagcggttttaacgcc
tgccctgtgctgaaagtacgcattgaagattatgatcttgaagctgatgaacagtcactg
gaacctttgatcgaaaaaatcagtcacgtgatcaatgaaaacagaaagaaataa

DBGET integrated database retrieval system