KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_00235Help
Entry
BAMTA208_00235    CDS       T01824                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00900  Terpenoid backbone biosynthesis
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01130  Biosynthesis of antibiotics
Module
baz_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMTA208_00235 (ipk)
Enzymes [BR:baz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BAMTA208_00235 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEB22239
Position
49803..50672
Genome map
AA seq 289 aa AA seqDB search
MRILEKAPAKINLSLDVTSKRPDGYHEVEMIMTTIDLADRIELTELPENVIRVASHNRFV
PDDQRNLAYQAAKLLKERYQVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWDLK
LSVEELAELGAEIGSDVSFCVYGGTALATGRGEKIRHISAPPHCWVVLAKPTIGVSTAEV
YRRLNLQQVRHPDVQAMIDAIEEKSFQKVCGQLGNVLESVTLNLHPEVAMIKNQMKRFGA
DAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagaaaaagcgccggccaaaatcaatctgtccctcgatgtaacgagtaaa
cgcccggatggttatcatgaagtggagatgatcatgacgacaattgatttggcagatcgg
attgaactgacagaactgcccgaaaacgtgatcagagtggcgtcgcataatcgctttgtt
cccgatgatcagcggaatctggcttatcaggcagccaaactgctcaaagaacggtaccaa
gtcaaaaaaggcgtttctattatgattacaaaagtgatacctgtagcagcagggcttgcc
ggcggaagcagcgatgcagcagccacgctcagagggctgaacagactctgggatttaaag
ctttctgttgaagagctcgcggagcttggggctgaaatcggttcagacgtgtccttctgt
gtatacggcggaactgccctggcaacaggacgcggtgagaagatcaggcatatcagtgct
ccgcctcattgctgggtcgtgcttgccaaaccgacgattggggtatcgactgccgaagtg
taccgccggctgaacttgcagcaggttcggcatccggatgtacaagcgatgattgacgca
attgaagaaaaaagtttccaaaaggtttgcggacaattaggaaacgtattggaatcggtt
acgctcaaccttcatcccgaggtggcgatgattaaaaatcaaatgaaacgcttcggcgct
gacgcggtgttaatgagcggaagcggaccgactgtattcggtttggttcaatacgaatca
aaggtgcagcggatttataacgggttaagaggtttctgtgatcaggtgtacgcggtgcgg
atgatcggcgaacagaatgctcttgattaa

DBGET integrated database retrieval system