KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_00390Help
Entry
BAMTA208_00390    CDS       T01824                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:baz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
81900..82757
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLIMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPAIERITSELDVPISIDTYKASVADEAVKAG
ASIINDIWGAKGDPDMASVAAAHSVPIILMHNRKERNYNDLIPDMLADLMESVKIAAEAG
VSDENMILDPGIGFAKSYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKQIARMTKMMDAMLNKGGAHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacactcattatggggatattaaatgtaacgccagactccttctctgac
ggcggtaaatacgacagtacggaaagagcgcttctccatgcggcgaagatggctgaagaa
ggggcgcacatcatagatatcggcggagaatcgacaaggcccggcgcatcactcgtgtcg
gctgatgaggaaatgtcacgtgtaatccccgccatagagcggatcacaagcgaactggac
gttccgatttcaattgatacgtacaaagcgtccgtagcagacgaagcggtcaaagcgggg
gcctccatcattaatgacatctggggggcgaaaggtgatcctgacatggcgtcagtagcc
gccgcacacagtgttccgattatcttaatgcataatcgcaaggagagaaactataacgat
ctgattcctgatatgctcgcagatttgatggaaagtgtaaaaattgccgcagaagccggc
gtttcagatgaaaacatgattctggatccggggatcggcttcgcgaaaagctatgaggac
aatctggctgtcatgaacaagctggaagtgttcagcgggttagggtatccgctgctcctc
gcgacatcgagaaaaagattcatcggccgtgtgcttgaccttcctcctgaagaacgtgcc
gaggggacgggagcgacggtatgccttggcgtccagaaaggctgcgacattgtgagggtg
cacgatgtcaagcagatcgcgagaatgactaagatgatggatgctatgttgaataaagga
ggcgcacatcatggataa

DBGET integrated database retrieval system