KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_00400Help
Entry
BAMTA208_00400    CDS       T01824                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:baz00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83109..83612
Genome map
AA seq 167 aa AA seqDB search
MNNTAYIGLGSNMGDREHYLRQAVAMLSRQDGVTVSKVSSIYETDPVGYEDQDQFLNMAV
EVKTALSPFDLLDVTQSIEAELGRTREIRWGPRTADLDILLYNRENIETERLIVPHPRMY
ERLFVLAPLKEICPQADHITISAETNQEGVRVWKQKSGVDEFVHSES
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacacggcatatatcggcctcggctccaatatgggcgatcgtgaacactatttg
cgccaggcagtggccatgctcagccggcaggatggcgtgacggtgtcaaaagtgtcctcc
atatatgaaacggatcccgtcggctatgaggatcaggatcagtttctcaatatggcggtt
gaagtgaaaacggcattatcaccttttgaccttcttgatgtgacgcagagcattgaagct
gaattaggaagaacgagggagatccgctgggggccgcgaacggcagaccttgacattttg
ctgtataatcgtgaaaatattgaaacagagcggctgattgttccgcatccgagaatgtat
gagcgcttatttgtccttgcgccgttaaaagaaatttgtcctcaggcggatcatatcacc
ataagcgctgaaacaaaccaagaaggtgtaagagtatggaagcagaaatctggggtagac
gaattcgtgcattcagaaagctga

DBGET integrated database retrieval system