KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_04765Help
Entry
BAMTA208_04765    CDS       T01824                                 

Gene name
hemY
Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00860  Porphyrin and chlorophyll metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BAMTA208_04765 (hemY)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BAMTA208_04765 (hemY)
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     BAMTA208_04765 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 MCRA HI0933_like Pyr_redox_2 Trp_halogenase Pyr_redox T7SS_ESX1_EccB Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEB23134
Position
969974..971407
Genome map
AA seq 477 aa AA seqDB search
MSGDKKHLVIIGGGITGLAAAFYMEKEIKEKQLPLEITLIEAGPRAGGKIQTAHKDGYII
ERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNETLHPMPKGAVMGIPTKIAP
FISTGLFSVPGKARAALDFVLPASKPKEDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGD
IDKLSLMSTFPQFYQTEQKHRSLILGMKKSRPQPSGQQLTAKKQGQFLTLTTGLQTLVEE
LEKQLTLTKVMKGTKVTHIGREEKGYSVTLDNGSVLHAEGCIVTAPHKAAAKMLSDLPAV
SCLKDMHSTSVANVALGFPEGAVKMEHEGTGFVISRNSDFSITACTWTNKKWPHAAPEGK
TLLRAYVGKAGDESIVDLSDNEIIKIVMEDLKKVMKINGEPEMTCVTRWNESMPQYHVGH
KERIKEFRDELKASYPGVYATGASFEGVGIPDCIDQGKAAVYDSLAYLFETYQPPLS
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgataaaaaacatctggtcatcatcggcggcggcataacgggattagccgcc
gccttctacatggaaaaagaaatcaaggaaaaacagctgccgcttgagattactttgatc
gaagcaggcccgcgagcgggcgggaaaattcagacggcccataaagacggctacatcatc
gagcgggggccggattcttttttggaaaggaaaaaaagcgctccgcagctcgtgaaggat
ctggggcttgagcatctgctcgtcaacaatgcgaccggccagtcttacgtgcttgtcaac
gagacgcttcatccgatgccgaagggcgcggtgatgggcatcccgacaaaaatcgctccg
ttcatctccaccggcttattttctgttcccggaaaagcgcgggcggcgctggattttgtc
ctgcctgcgagcaaaccgaaggaagatcagtctctgggtgagtttttccgcagacgcgtc
ggtgacgaagttgttgagaatttaatagaaccgctgttgtctgggatttatgccggagat
attgataagctgagccttatgtccacgtttccgcaattctatcagactgagcaaaagcac
agaagtctgattctcggcatgaaaaaatcgcgtccgcagccttcgggacagcagctgacg
gccaaaaagcagggccagtttttaacactgacgacaggccttcaaactttggtggaggag
ctggaaaagcagcttacactgacaaaggtgatgaaaggcacgaaagttacccatatcggc
cgcgaggagaagggatattccgtgacgcttgataacggcagtgtgctgcatgcggaagga
tgcattgtgacagcgccgcataaagccgcggcgaaaatgctttctgatttgccggcggtg
tcatgtctcaaagacatgcattctacgtccgttgccaacgtcgccttaggttttccggag
ggagccgtcaagatggagcatgaaggtacgggattcgttatctcaagaaacagcgatttc
tccatcacggcctgcacatggacgaataaaaaatggccgcacgcggcgccggagggcaaa
acgcttctcagggcgtacgttggaaaggccggagatgaatccatcgtagatctttcagat
aacgagatcattaaaatcgtaatggaagatttgaaaaaagtaatgaaaatcaatggcgaa
ccggaaatgacctgtgtcacccgctggaacgaaagcatgccgcagtaccatgtcggccat
aaagagcgcatcaaagagttcagagatgagctgaaagcttcctatccgggtgtatacgcg
acgggcgcatcttttgaaggggtgggcatccccgactgtatcgaccagggaaaagccgca
gtatatgattcactggcttatttatttgaaacgtaccagcctccgttatcttaa

DBGET integrated database retrieval system