KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_04835Help
Entry
BAMTA208_04835    CDS       T01824                                 

Gene name
aprE
Definition
extracellular alkaline serine protease
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
baz  Bacillus amyloliquefaciens TA208
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(985199..986347)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKA
PALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVG
PELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDSFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaagtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacatcctctgcccaggcggcagggaaatcaaacggggaaaagaaatat
attgtcgggtttaaacagacaatgagcacgatgagcgccgctaagaagaaagatgtcatt
tctgaaaaaggcgggaaagtgcaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaacgaaaaagctgtaaaagaattgaaaaaagacccgagcgtcgcttacgttgaagaa
gatcacgtagcacatgcgtacgcgcagtccgtgccttacggcgtatcacaaattaaagcc
cctgctctgcactctcaaggctacactggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagacaacaactctcacggaactcacgttgccggcacagttgcg
gctcttaataactcaatcggtgtattaggcgttgcgccaagcgcatcactttacgctgta
aaagttctcggtgctgacggttccggccaatacagctggatcattaacggaatcgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgct
gctttaaaagcggcagttgataaagccgttgcatccggcgtcgtagtcgttgcggcagcc
ggtaacgaaggcacttccggcagctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcagtaggcgctgttgacagcagcaaccaaagagcatctttctcaagcgtagga
cctgagcttgatgtcatggcacctggcgtatctatccaaagcacgcttcctggaaacaaa
tacggggcgtacaacggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgattctttctactatggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system