KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_04850Help
Entry
BAMTA208_04850    CDS       T01824                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BAMTA208_04850 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BAMTA208_04850 (yhfS)
   00640 Propanoate metabolism
    BAMTA208_04850 (yhfS)
   00650 Butanoate metabolism
    BAMTA208_04850 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    BAMTA208_04850 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BAMTA208_04850 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAMTA208_04850 (yhfS)
   00310 Lysine degradation
    BAMTA208_04850 (yhfS)
   00380 Tryptophan metabolism
    BAMTA208_04850 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BAMTA208_04850 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAMTA208_04850 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BAMTA208_04850 (yhfS)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BAMTA208_04850 (yhfS)
Exosome [BR:baz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BAMTA208_04850 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(988316..989407)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPENLAAPLIRYLSRNMAEDIDEVLIGNATGRGGNLA
RLSALTAGLPLSVPGTTIDRQCGSGLDAMRIACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYAVTRKMQDEYALLSYERSFKAHEDGLYRQEILPCHG
FAADENMLKKRNMEPLIARAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
KLRFIGSTVSGVHPHYPSAAPVYAVKKLLKEQNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVSRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacgaacgattttcgcccgggaaaacggcctgtta
aaagattgtcttcctgaaaatttagcagctccgctgatccgctatttgagccggaacatg
gcagaagacattgatgaagttctgatcggaaatgcgacaggccgcggcgggaacctcgcc
cggctatcagccttgacggccgggcttcctttgagcgtgcctgggacgaccatcgacaga
cagtgcggttccgggctggacgccatgagaatcgcgtgccattttgtaaaagccggcgcg
gggagcacgtacatcgcgggaggagcggagagcagcagccgctcccctttttcttcccgc
gcgcgtttttcacctgaacatatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacgcagtcacgagaaaaatgcaggacgaatatgccctcctcagctatgaa
cggagcttcaaagcgcacgaagacggcctgtaccgacaggaaatcctcccgtgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggaacctcttatcgcccgcgcc
aaacccgtctttcagtccggcggctctgtcaccgccgccaacagctgcggcatttctgac
ggggcggcggcggtttgtgtaatggaagaacaaaaagcgcggtccctcggtttaaaaccg
aaattgcgttttatcggaagcacggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggagcagaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgtcttttcacaacagcttcaa
gtgccatattctaaaataaatgtccggggcggcgctctagccgtcgggcatccgtacggg
gcttccggggcggcgcttgtctcccggcttttttatgaagcaaaaagacggccggatgcc
cgctacgcagcagcagcgatcggcagcgggggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system