KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_05575Help
Entry
BAMTA208_05575    CDS       T01824                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00790  Folate biosynthesis
baz01100  Metabolic pathways
Module
baz_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAMTA208_05575 (folE)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BAMTA208_05575 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AEB23296
Position
1115379..1115951
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPDREGLLDTPKRVAKMYAEVFSGLNEDPKEHFKTVFG
EDHEELVLVKDIAFHSMCEHHLVPFYGKAHIAYIPRGGKVTGLSKLARAVEAVSKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGIFKDDAAARS
EVLEHIKRAD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagaacagattgaacaggcagttcgccagattttagaggcgatt
ggagaagacccggaccgggaagggcttttagatacgccgaaacgtgtagcaaaaatgtac
gctgaagtattctcgggattaaacgaagacccgaaagagcattttaaaaccgttttcggc
gaggatcatgaggagcttgttcttgtaaaagatatcgcgtttcattctatgtgtgaacat
catcttgttcctttttacggaaaagcgcatattgcctacattccgcgcggcggtaaagtg
acgggcctgagtaaactggcgcgtgcggtagaagccgtctcaaaacgcccgcagctgcag
gagcgcattacgtcaacgattgcagaaagcatcgtagaaaccttagatccccacggcgtc
atggttgtcgtcgaagctgagcatatgtgcatgacgatgagaggcgttagaaagccgggg
gcaaaaacagtaacttccgctgtaagaggtatttttaaagatgacgcagcggcgcgttct
gaagtgttagaacatattaaacgtgcggattaa

DBGET integrated database retrieval system