KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_05645Help
Entry
BAMTA208_05645    CDS       T01824                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BAMTA208_05645 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BAMTA208_05645 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAMTA208_05645 (trpB)
Enzymes [BR:baz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BAMTA208_05645 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127191..1128393
Genome map
AA seq 400 aa AA seqDB search
MYPYPNEIGRYGEFGGKFVPETLMRPLEEIETAFKELKNDPVFHAEYKKLLFDYSGRPTA
LTFADRVSDDLGGAKIYLKREDLNHTGSHKINNALGQILLAKKMGKTKIIAETGAGQHGV
AAATAAAKFGFECTVFMGEEDVARQSLNVFRMKLLGAEVVPVSSGNGTLKDATNEAIRYW
VQHCEDHFYLIGSVVGPHPYPYIVREFQKIIGEEAKEQLLRVEGTLPDKVVACVGGGSNA
MGIFQAFLDEDTELIGVEAAGKGIDTPLHAATIAKGTLGVIHGSMTYLIQDAYGQIIEPY
SISAGLDYPGIGPEHAYLHKSGRVTYESVTDEEAIAALRLLSETEGILPAIESAHALAKA
FEMAKDMDKDKIILVSLSGRGDKDVHTLMNVLENGVKTHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtatccatatccaaatgaaatcggaagatacggcgaattcggaggcaaatttgtccct
gaaacattgatgcggcctctcgaagaaatcgaaacggctttcaaagaattaaagaatgat
cccgtatttcatgcagaatataaaaaactattgtttgattactccggaagaccgactgca
ttgacgtttgcagacagggtgtcggatgatttgggcggggcgaaaatctatttgaaaagg
gaagatttaaaccataccggttctcataaaatcaacaacgcgttaggacagattctgctt
gccaaaaagatgggcaaaacgaaaatcatcgccgaaaccggtgcggggcagcacggcgtt
gcagccgcgacagccgccgcaaaattcggttttgagtgtacggtttttatgggtgaagag
gacgttgcgcgccagtcgctgaacgtattccgaatgaaactgctcggcgcggaggtcgtg
ccggtctctagcggcaacggcacactgaaagatgcgacgaatgaagcgatcagatattgg
gttcagcattgtgaagaccatttttacctgatcggttctgtcgtaggtccgcacccgtat
ccgtacattgtgcgcgagtttcagaaaatcatcggcgaggaagcgaaagaacagctcctc
agggtcgaagggacgctcccggacaaggttgttgcatgtgtcggcggcggaagcaatgcg
atgggcatatttcaggcctttttagacgaagatactgagctgatcggcgtcgaggcggcc
ggaaaaggaattgatacgcctctgcatgcggcgacgatagcaaaagggacgctcggggtg
attcacggctcaatgacctatttaatacaagatgcatacggacagattatcgaaccgtat
tccatttcagcaggcctcgattacccggggatcgggcctgagcatgcctatctgcataaa
agcggccgtgtaacatatgaaagtgtgacagacgaagaagcgattgccgcgttgcgtctg
ctttctgaaacagaaggcattcttccggctattgaatctgcacacgccttggcaaaagca
tttgaaatggcgaaagacatggataaagacaaaatcattctcgtcagtctgtcgggaaga
ggagataaagatgttcatacgctgatgaatgttttggaaaacggggtgaagacacatgtt
taa

DBGET integrated database retrieval system