KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_06890Help
Entry
BAMTA208_06890    CDS       T01824                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BAMTA208_06890
   00670 One carbon pool by folate
    BAMTA208_06890
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     BAMTA208_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309656..1310174
Genome map
AA seq 172 aa AA seqDB search
MLSLIACCDKSMAIGYENNLLYHIPEDMKRFKELTTGKLCIQGRLTYESIVNITGKPLQN
RSNIILTKNKDFKPDHSSFVYHSVNDVLKLIRGQLDKDEEVMVIGGGAIYEAFLPHADKV
YLAIVDSVVAKADSYFPRLNDDWRVIEKDHRSAITTKGQDYSFITYENFRKP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgctatctcttattgcttgctgcgacaaatcaatggccatcgggtatgagaataatttg
ctttaccatattcctgaagacatgaaacgttttaaagaactcactacaggaaagctgtgt
atacagggaaggcttacatacgaatcaatcgtaaacattacaggaaaaccacttcaaaac
cgaagtaatatcatattgactaaaaataaagatttcaagcctgatcactcttcatttgtt
tatcattcggttaacgatgtattaaagcttatacgaggacaattggataaagatgaagag
gtaatggtcattggaggaggtgctatatacgaggcattcttaccccatgcagataaggtt
tatttagcgattgttgattcagtcgttgcgaaggcagattcatattttccaaggttaaat
gatgactggagagtaattgaaaaggatcatcggagtgcaataacaacaaaaggacaggat
tattcatttattacttatgaaaatttcagaaaaccatag

DBGET integrated database retrieval system