KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_07480Help
Entry
BAMTA208_07480    CDS       T01824                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAMTA208_07480 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAMTA208_07480 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BAMTA208_07480 (odhB)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAMTA208_07480 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397236..1398483
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPAKEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQTKPQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNEVK
LGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEKEIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaacttgagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacctgccccttccgaaagtgctccagccaaagaacaaacgaaagaggaa
gcaaaagctgaaccggctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctttca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagacgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagacgaaaccgcaggctcaaaaaacacagcaaagc
tttgacaaacctgttgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgacgacatttaacgaagtggacatgacg
gctgttatgaatttaagaaaacgccgtaaagaccaattccttgagcaaaacgaagtaaaa
ctcggtttcatgtctttctttacaaaagccgtagtggcagctttgaaaaagtacccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gccgttgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgatcgtctgaca
tttgccggcattgaaaaagagatcggcgaacttgcgaagaaagcacgaaacaataaatta
acattaggtgagctgcaaggaggttccttcacgatcacaaacggaggtacattcggctcg
cttatgtcaacaccaatcctaaacagccctcaggtcggaatcttaggtatgcacaaaatt
cagctgcgccctgtagcgatcgatgcagagcgttctgaaaaccgtccgatgatgtacctt
gctttatcatatgatcacagaatcgtagatggtaaagaagcggtcggattccttgtcaca
attaaaaacctgctggaagatccggaacagctgttattggaaggataa

DBGET integrated database retrieval system