KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_07480Help
Entry
BAMTA208_07480    CDS       T01824                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:baz01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:baz00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:baz00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1397236..1398483
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPAKEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQTKPQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNEVK
LGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEKEIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaacttgagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacctgccccttccgaaagtgctccagccaaagaacaaacgaaagaggaa
gcaaaagctgaaccggctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctttca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagacgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagacgaaaccgcaggctcaaaaaacacagcaaagc
tttgacaaacctgttgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgacgacatttaacgaagtggacatgacg
gctgttatgaatttaagaaaacgccgtaaagaccaattccttgagcaaaacgaagtaaaa
ctcggtttcatgtctttctttacaaaagccgtagtggcagctttgaaaaagtacccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gccgttgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgatcgtctgaca
tttgccggcattgaaaaagagatcggcgaacttgcgaagaaagcacgaaacaataaatta
acattaggtgagctgcaaggaggttccttcacgatcacaaacggaggtacattcggctcg
cttatgtcaacaccaatcctaaacagccctcaggtcggaatcttaggtatgcacaaaatt
cagctgcgccctgtagcgatcgatgcagagcgttctgaaaaccgtccgatgatgtacctt
gctttatcatatgatcacagaatcgtagatggtaaagaagcggtcggattccttgtcaca
attaaaaacctgctggaagatccggaacagctgttattggaaggataa

DBGET integrated database retrieval system