KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_08285Help
Entry
BAMTA208_08285    CDS       T01824                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BAMTA208_08285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMTA208_08285
  Lipid metabolism
   00071 Fatty acid degradation
    BAMTA208_08285
  Amino acid metabolism
   00350 Tyrosine metabolism
    BAMTA208_08285
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BAMTA208_08285
   00626 Naphthalene degradation
    BAMTA208_08285
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BAMTA208_08285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1579751..1580767
Genome map
AA seq 338 aa AA seqDB search
MKAVIATKDKNIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVSSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAVKVPEHLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVEKAKEVTSDLGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFRFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgtaatagcgacgaaagacaaaaatatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgtgacaggcgtcactttaggtcatgaagga
ataggcattgtaaccgagattggtgaaggcgtatcaagcctgaaaaaaggagaccgcgtc
tctattgcgtggatgtttgaaagctgcggccgctgtgaatattgcttaacaggccgtgaa
accctgtgccgtgatgtaaaaaatgccggctatacagttgatggcgcgatggctgaagaa
gcaatcgtagcggttgattatgcagtgaaagtgcctgaacatttagatccggcagcagca
agcagcattacttgtgcaggcgtaacaacttataaagcagtaaaagtcagtgaaattaag
cctggtcaatggatcggtgtatttggagtcggcggtttgggcaacttggctgttcaatat
gcaaagaatgtctttaacgctaaagtgattgctttcgacattagcgatgaaaagttgaat
tttgctaagagcttaggtgctgacgcggttgtaaacagtttaaacgaagaccctgtcgag
aaggctaaagaagtgaccagcgatttaggacttgatgctgcggtcattaccgctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcgcgagtagttgctgtc
ggtttaccggtagataagatggacttagatattccccgtcttgtgttagatggaattcag
gtagtaggttcattagtaggtaccagagaagacctgaaggaagctttccgattcgctgca
gacggtaaagttgtacctaaagtgacaaagcgcccgatcgaagacgtgaatgatatattt
gaagaaatggagcaaggtaaagtgaccggccgtatggttatagattttacttgttaa

DBGET integrated database retrieval system