KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_08330Help
Entry
BAMTA208_08330    CDS       T01824                                 

Gene name
xynA2
Definition
protein XynA
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
baz  Bacillus amyloliquefaciens TA208
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1590282..1590980)
Genome map
AA seq 232 aa AA seqDB search
MKQKRMKFLLAVLFSLALTLPAWSAQAATTITSNQTGTQDGYDYELWKDSGNTSMTLNSG
GAFSAQWSNIGNALFRKGKKFDSTKTHSQLGNISINYNATFNPGGNSYLCVYGWTKDPLT
EYYIVDNWGTYRPTGTPKGTFTVDGGTYDIYETTRINQPSIIGIATFKQYWSVRQTKRTS
GTVSVSEHFKKWESLGMPMGKMYETALTVEGYQSNGSANVTANVLTISGKSF
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaaagaatgaagtttttattagcagttttatttagtctggcgctgacatta
cctgcatggtccgcacaggcggcaactacaatcacctcaaatcagactggcacacaagat
ggctatgactatgaattgtggaaggactctgggaataccagtatgacgcttaatagcggc
ggtgcgttcagtgcccagtggagtaacattgggaatgctttattccgaaaaggcaagaaa
ttcgattcaacgaagactcactcacaacttggaaacatatcaatcaattacaacgcaacc
ttcaatcccggggggaattcctatctgtgtgtttatggatggacgaaagatccgctcaca
gaatattatatcgtcgataattggggcacctacagaccgactggaacgccgaagggaact
tttactgttgacgggggcacatatgacatttatgaaaccactcgaatcaaccaaccttcc
attataggtatcgccacctttaaacagtattggagtgtccggcagacaaaacgaacgagc
ggaaccgtatctgtcagcgaacatttcaagaagtgggaaagcttagggatgccaatgggt
aagatgtatgaaaccgcgcttacggtagaaggatatcaaagcaatggcagtgctaatgta
actgcaaatgtactgactattagcggaaaatccttttag

DBGET integrated database retrieval system