KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_09845Help
Entry
BAMTA208_09845    CDS       T01824                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00010  Glycolysis / Gluconeogenesis
baz00020  Citrate cycle (TCA cycle)
baz00620  Pyruvate metabolism
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01120  Microbial metabolism in diverse environments
baz01130  Biosynthesis of antibiotics
baz01200  Carbon metabolism
Module
baz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMTA208_09845 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BAMTA208_09845 (pdhC)
   00620 Pyruvate metabolism
    BAMTA208_09845 (pdhC)
Enzymes [BR:baz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BAMTA208_09845 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N DUF1533 DUF5077
Motif
Other DBs
NCBI-ProteinID: AEB24136
Position
complement(1945304..1946632)
Genome map
AA seq 442 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVEEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGSDESGDAKTEAQVQSSAEAGQDVAKEERAAEP
AKETGAGQQDQAEADPNKRVIAMPSVRKYAREKGVDIRKVTGSGNNGRVVKEDIDSFVNG
GAAQEAAPQKTAAPQETAKPAAAQAPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTL
MDEVDVTNLVAHRKQFKQVAADQGIKLTYLPYVVKALTSALKKFPVLNTSIDDKTDEVIQ
KHYFNIGIAADTEKGLLVPVVKNADRKAVFEISDEINSLATKAREGKLAPAEMKGASCTI
TNIGSAGGQWFTPVINHPEVAILGIGRIAEKAIVRDGEIVAAPVLALSLSFDHRMIDGAT
AQNALNHIKRLLNDPQLILMEA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggatatcggggaaggtatccacgaaggcgaaatcgta
aaatggtttgttaagccaaacgacgaggtagaagaagacgatgtactggctgaagtgcaa
aatgataaagcagtggtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacggttgcaactgttggacaaacgattattacgtttgacgcacctggt
tacgaagatcttcaatttaaaggaagcgacgaatccggcgatgcgaaaactgaagcgcaa
gttcagtcttcagctgaagcaggacaggacgtagcgaaagaagaacgcgcagcagagcct
gcaaaagaaaccggcgcaggacagcaggaccaagcggaagctgatccgaacaaacgcgtg
atcgctatgccttccgtacgcaaatatgcccgtgaaaaaggcgttgatatccgcaaagtt
acaggttcaggaaataacggacgtgttgtaaaagaagatatcgacagctttgtaaacgga
ggagcggctcaagaagcggcaccgcaaaaaacagcagcacctcaggaaacagctaaacct
gcagcagctcaagctcctgaaggcgaattccctgaaacacgcgaaaaaatgagcggtatc
cgtaaagcgattgctaaagcaatggtgaactctaagcatactgcaccgcacgtaactctt
atggatgaagttgacgtaacaaatcttgttgctcaccgcaaacagttcaaacaagttgct
gctgatcaaggcatcaagctgacttacctgccttacgtcgtaaaagcattaacatctgct
ctgaaaaaattccctgttttaaacacatctattgatgataaaacagatgaagtgatccaa
aaacattatttcaacatcggaattgcagcggatactgaaaaaggcttgcttgtgccagta
gtgaaaaatgccgaccgtaaagccgttttcgaaatctctgatgaaatcaacagccttgct
acaaaagcgcgtgaaggcaagcttgcacctgcggaaatgaaaggcgcttcttgcacaatc
acaaatatcggttctgccggaggccaatggttcacaccggttatcaaccacccagaggtt
gcgattctcggtatcggccgcatcgctgaaaaagcgatcgtccgcgacggtgaaattgta
gctgctcctgtcttagctctttctctcagctttgaccaccgtatgattgacggagcaact
gcacaaaatgcgttaaaccacatcaagcgtttactgaacgatccacaacttattttaatg
gaggcgtaa

DBGET integrated database retrieval system