KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_12475Help
Entry
BAMTA208_12475    CDS       T01824                                 

Gene name
yqxC
Definition
methyltransferase with RNA binding domain
Orthology
K06442  
23S rRNA (cytidine1920-2'-O)/16S rRNA (cytidine1409-2'-O)-methyltransferase [EC:2.1.1.226 2.1.1.227]
Organism
baz  Bacillus amyloliquefaciens TA208
Brite
Enzymes [BR:baz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.226  23S rRNA (cytidine1920-2'-O)-methyltransferase
     BAMTA208_12475 (yqxC)
    2.1.1.227  16S rRNA (cytidine1409-2'-O)-methyltransferase
     BAMTA208_12475 (yqxC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2391256..2392101)
Genome map
AA seq 281 aa AA seqDB search
MTAKKERLDVLLVEKGLAETREKAKRAIMAGIVYSNENRLDKPGEKIARDLPLTVKGNPL
KYVSRGGLKLEKALEVFPVSVTGKTMIDIGSSTGGFTDCALQNGAERSYAVDVGYNQLAW
KLRQDERVVVMERTNFRYSEPSDFTEGLPEFATIDVSFISLRLILPVLKTLLVPGSDCIA
LVKPQFEAGRESVGKKGIVRDPGVHADVLRRMNQFAASEGYAVKGLSFSPITGGDGNIEF
LLHLNWEGEDGNGTELPEEDILRTVREAHETLKAKKTDVPE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaaaaagaacgattagatgtacttcttgtagaaaaaggacttgcggagacg
cgggaaaaagcgaaacgcgccattatggcggggatcgtgtactcaaatgaaaaccgattg
gacaagccgggtgaaaaaatcgcccgggatcttccgttaacggtaaaaggaaaccctctt
aaatacgtcagcaggggcggattaaagcttgaaaaagctcttgaggtgttccctgtctca
gtaacaggcaaaacgatgattgacatcggctcgtcgacaggaggatttacagattgcgcc
ctccaaaacggcgccgagcggtcatacgcagtagatgtcggctataatcagcttgcttgg
aagctgaggcaggacgagagggtcgtcgtaatggaacggacgaatttccgctattccgag
ccttctgatttcacagagggtttgccggaatttgcgacgatcgatgtgtctttcatctca
ctccgcctcattctgccggttttaaaaacgctgcttgtaccgggaagcgattgtatcgct
ctggtgaagccgcaatttgaagccggacgggaatcagtcggaaaaaaaggcattgtcaga
gatcccggcgttcatgctgacgttctccgccgtatgaatcaatttgccgcctctgaagga
tatgcagtgaaaggactgtccttctcaccgattacagggggagacggcaatattgagttt
ctgcttcatctgaactgggagggagaagacggaaacggcactgaactgccggaagaagac
attctccgtaccgtccgcgaagcacatgagacattaaaagccaaaaagacagatgtaccg
gaataa

DBGET integrated database retrieval system