KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_12770Help
Entry
BAMTA208_12770    CDS       T01824                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
baz00010  Glycolysis / Gluconeogenesis
baz00052  Galactose metabolism
baz00500  Starch and sucrose metabolism
baz00520  Amino sugar and nucleotide sugar metabolism
baz00521  Streptomycin biosynthesis
baz01100  Metabolic pathways
baz01110  Biosynthesis of secondary metabolites
baz01120  Microbial metabolism in diverse environments
baz01130  Biosynthesis of antibiotics
baz01200  Carbon metabolism
Module
baz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
baz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAMTA208_12770 (glcK)
   00052 Galactose metabolism
    BAMTA208_12770 (glcK)
   00500 Starch and sucrose metabolism
    BAMTA208_12770 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    BAMTA208_12770 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BAMTA208_12770 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BAMTA208_12770 (glcK)
Enzymes [BR:baz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BAMTA208_12770 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AEB24715
Position
complement(2436049..2437011)
Genome map
AA seq 320 aa AA seqDB search
MEETWFAGIDLGGTTIKLAFINMYGEIQHKWEVPTDKSGNTITVTIAKALDQKLEELNKP
KRIVKWIGMGAPGPVEMATGMVYETTNLGWKNYPLKDHLEAETGIPAVIENDANIAALGE
MWKGAGDGAKDVILVTLGTGVGGGIIVNGEIVHGKNGAGGEIGHICSIPEGGAPCNCGKS
GCIETIASATGIVRIAKEKLAAVSDSSLLQVRDLTARDVFEAAKQQDKTALEVVDYVAKH
LGLVLGNLASAMNPTKIVLGGGVSKAGEILRSKVEETFKITAFPRSAEAADISIAALGND
AGVIGGAWIAKNEWLKYQNC
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaagagacatggtttgcggggattgatcttggcggaacaaccatcaagctggccttt
atcaacatgtacggtgaaattcagcacaaatgggaggttccgaccgataaatcaggaaac
acaattacggtcacgatcgctaaagcacttgaccagaaactcgaagaattgaataagccg
aaacggatcgtaaaatggatcggcatgggagcgcccggacccgtggaaatggcgacgggg
atggtttatgagacgacaaatctggggtggaaaaactatcccttgaaagaccatctcgag
gcggaaacgggtattccggccgtcattgaaaacgatgccaatatcgcggcgctcggagaa
atgtggaaaggtgcaggcgacggagctaaagatgtcattttagtgacgcttggaaccgga
gtcggcgggggcatcatcgtcaacggagaaatcgttcacggtaaaaacggggcaggcgga
gaaatcggtcatatttgcagtatcccggaaggcggggctccgtgcaactgcggaaaatcc
ggctgtattgaaacgattgcgtcagcaaccggcatcgtccgcatcgcgaaagaaaagctt
gcagcggtttccgactcttcgctcctgcaagtgcgcgatctcacggcacgtgacgtgttc
gaagcggcaaaacagcaggataagacagcgctggaagtcgtcgattatgtcgcaaaacat
ttaggccttgtgctcggaaacctggcaagcgccatgaacccgactaaaatcgtgctcggc
ggaggcgtctcgaaagcaggagaaatactgcggtcaaaagtggaagagaccttcaaaatc
accgcgttcccgcgttctgcggaagcggccgatatttcgattgcggcacttggaaatgac
gccggagtcatcggcggggcgtggattgccaaaaatgaatggcttaaatatcaaaactgc
tag

DBGET integrated database retrieval system