KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_13325Help
Entry
BAMTA208_13325    CDS       T01824                                 

Gene name
cypB
Definition
YrhJ
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:baz00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BAMTA208_13325 (cypB)
  Amino acid metabolism
   00380 Tryptophan metabolism
    BAMTA208_13325 (cypB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BAMTA208_13325 (cypB)
Enzymes [BR:baz01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     BAMTA208_13325 (cypB)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     BAMTA208_13325 (cypB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2535707..2538868)
Genome map
AA seq 1053 aa AA seqDB search
MKQLSAIPQPKTYGPLKNLPHLEKEKLSQSLWKIAEEYGPIFRFEFPSSVGVFVSGRELA
AEVCDEKRFDKNLGKALLKVREFGGDGLFTSWTNEKNWQKAHRILLPSFSQKAMKGYHSM
MLDIAMQLVQKWSRLNPNEEIDVAEDMTRLTLDTIGLCGFHYRFNSFYRDTQHPFITSML
RALQEAMRQSQRHSLQDKLMIKTRHQFQQDIEEMNALVDRIIAERRENPDENLSDLLALM
LEAKDPVTGERLDDENIRYQIITFLIAGHETTSGLLSFAIYCLLKNKDKLEKAVQEAERV
LTGETPEYKQIQQLTYIRMVLNETLRLYPTAPAFSLYAKEDTVLGGKYPIEKGQPVTILT
PQLHRDKSAWGEDAELFRPERFSDPAAIPADAYKPFGNGQRACIGMQFALQEATMVLGLV
LKHFELIDHSDYELTIKEALTIKPGDFKIRVKNKDVSNRQTAQNHKAEGSDHKEETKEIP
SHGTPLLILYGSNLGTAEGIAEELADIGRSKGFSTETGPLDDYAGKLPVKGAVVIVTASY
NGAPPDNAAGFVKWMETLEDQELKGVSYAVFGCGDRNWAATYQKIPRLIDKVLEEKGATR
LTSIGEGDNADDFEYSQEAWEDSFWQDIIKAFHIEAAPEQQNKSQLSIEYVSEAAETPIA
KTYKAFEAEVITNKELHTESSTRSVRHIELRLPETETYQEGDHLGVLPQNSGELISRVIH
RFALDPNQHFKISGRHLPHLPMDRPVNALELLASYVELQEPATRAQLRELAAHTVCPPHQ
KELEHLYSDETAYKENVLKKRMTMLDLLEDYPACELPFERFLELLPSLKARYYSISSSPK
ANSGELSITVGVVTAPAWSGRGEYRGVASNYLAGLQNGDHAVCFIRSPQSGFALPENTKT
PLIMVGAGTGIAPFRGFIQARAAEKMSGNSLGEAHLYFGCRHPEEDDLYKDEFDQAEKTG
LVTVHRAYSRLDQDCKVYVQDVLLREAAQIIALLDQGGHLYICGDGSKMAPAVENVLLQA
YEKVHNTDSKVSLSWLEQLQAEGRYAKDVWAGV
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagctaagcgcaataccgcagccgaaaacatacggccctctgaaaaatctccct
cacttggaaaaagaaaagctttcacaatcgctttggaaaatagcggaggaatacggcccg
atctttcgttttgaattcccgagctctgtcggggtcttcgtatcaggccgcgagctcgca
gcagaagtctgtgatgagaagcgatttgacaaaaacctcggcaaagctttgctgaaagtc
cgtgaatttggcggtgacggattatttacgagctggacaaacgaaaagaattggcagaaa
gcgcatcggattttattgccgagcttcagtcagaaagcaatgaaaggctatcattcaatg
atgcttgatattgccatgcagctcgtgcagaagtggagcagattaaatccgaatgaagaa
attgacgtcgctgaagatatgacgcgcctgacgctggataccatcggcctgtgcggattt
cattaccgctttaacagcttttaccgcgacacacagcatccttttatcacaagcatgctt
cgtgcgctgcaggaggccatgcgccaatctcaacggcacagcctgcaggacaagctgatg
atcaaaacgagacatcagttccagcaggatattgaagagatgaatgcgcttgtagaccgg
atcattgctgagcggagggaaaatccggatgagaatctgtctgatcttttggcattgatg
cttgaagccaaagaccctgtaacgggtgaaaggctggatgatgaaaatatccgctatcaa
attattacctttttgatcgctgggcatgaaacgacaagcgggctgctttcttttgcgata
tactgcctgctgaaaaataaagataaattggaaaaagccgttcaggaagccgaacgggtg
ctgacgggagaaacccctgaatataagcagattcagcagctgacctatatccgcatggtg
ttaaacgaaacattgcggctttatccgactgccccggcattttctctgtacgcgaaggaa
gatacggttctcggcgggaaatatccgattgagaaaggacagcccgtgacgattctgact
ccgcagctgcaccgtgataaaagcgcgtggggagaagatgccgagttattccgccctgaa
aggttcagtgatcccgcggccattccggctgatgcgtataagccgttcggaaacggacag
cgcgcctgcatcgggatgcagtttgcccttcaggaagcgacgatggtgctcggtcttgtc
cttaagcattttgaactgattgatcattctgattatgagcttacgattaaagaagcttta
accattaagcccggcgattttaaaatccgggtgaaaaacaaggacgtgtccaatcggcag
accgcacagaaccataaagctgaaggaagcgatcacaaagaagaaacgaaagaaataccg
tcccacggaaccccgcttctcatcctttacggatcaaatttaggaactgcggaaggaatt
gcggaagagctggctgacatcggaagaagcaaaggcttttcaactgaaaccgggccgctc
gatgattatgccgggaaattgcctgtaaaaggcgctgtcgtgattgtaacggcttcttac
aacggggcgccgcctgataacgcggcgggttttgtcaagtggatggaaactcttgaagat
caggaattaaagggtgtttcttacgccgtcttcggctgcggagaccgcaattgggccgcc
acctaccagaagattccccgtcttatagacaaagtgcttgaagaaaaaggagcaacacgg
cttacctctatcggagagggtgacaatgccgatgattttgagtacagtcaggaagcttgg
gaagattcattttggcaggacatcatcaaggcttttcatatagaagccgctcccgaacag
caaaacaaatcacagctatcaatagaatatgtaagtgaagcagctgagacgccgattgcc
aaaacgtacaaagcgtttgaggcggaagtcatcacaaacaaagagcttcataccgaaagc
agcacgcgatcagtccggcacattgagctgcgtctcccggaaacagaaacttatcaggaa
ggagaccatctcggggtgcttccgcaaaacagcggggaactgatcagccgcgtcattcac
cggttcgctctcgatccgaatcagcactttaaaatcagcggacggcatttacctcatctg
ccgatggaccggccggttaatgcactggagcttttggcgtcatatgtagaactgcaggaa
ccggccacgagagcccagcttcgagaacttgccgcacataccgtgtgcccgccgcaccaa
aaagaattggagcatctttattctgatgaaacggcatataaagaaaacgtgctgaaaaaa
cgaatgaccatgctggatctgctggaagattatccggcatgtgaattgccgttcgagcgc
tttttagaacttttgccgtccttaaaggcgcgctattattcaatctcaagctcaccgaag
gcaaacagcggggaactcagtatcacagtcggcgttgtaacggctccggcttggagcggc
cggggagaatatcgcggtgttgcttcgaactacttagccggattacagaatggcgatcat
gccgtctgtttcatccgctcaccgcaatccggttttgcactgcctgaaaatacgaaaacg
cctctcattatggtcggagcgggcactggaatcgcgccgttcaggggatttatccaggcg
cgggctgccgaaaaaatgtccggtaacagcctgggggaagctcatttatactttggctgc
agacatcctgaagaagatgatctctacaaagatgaattcgatcaggcggagaaaacaggc
cttgtcaccgtgcatcgggcgtattcaaggttagatcaggactgtaaagtatacgtacag
gatgtcctgcttcgtgaggccgcacagattattgcgcttcttgaccaaggcggccatctc
tatatatgcggtgacggaagcaaaatggctccggccgtggaaaatgtcctgctgcaggcg
tatgaaaaggtgcataacactgattcgaaagtttccttgagttggcttgaacagctgcag
gcggaaggaagatatgcgaaagatgtgtgggcaggtgtgtaa

DBGET integrated database retrieval system