KEGG   Bacillus amyloliquefaciens TA208: BAMTA208_13495Help
Entry
BAMTA208_13495    CDS       T01824                                 

Gene name
yrrC
Definition
exonuclease with DNA/RNA helicase motif
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
baz  Bacillus amyloliquefaciens TA208
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:baz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAMTA208_13495 (yrrC)
Enzymes [BR:baz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BAMTA208_13495 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2568096..2570474)
Genome map
AA seq 792 aa AA seqDB search
MDQLKIEEQPYVKGVIHTVIYHNDTNLYTVLKVKVAETSEAIEDKVVSVTGYFPLLQEDE
TYTFYGKTATHPKFGLQFQAEHFKKEIPTTKEGIIHYLSSDLFEGIGKKTAEEIVKKLGD
GALNKILADASVLYDVPKMSKKKADKLAGELQRHQGLEQIMISLNQYGFGPQLSMKIYQA
YETETLEKIQENPYQLVKDVEGIGFVKADELGGKMGLSGNHPERIKAAILYTIESTCLSE
GHTYIDTKQLIINTQTLLNQSADGGRVTEMDAADGIIALGESKDIVIEGDRCYFPSLFYA
EQNVAKRVLDIAAQTEYADQFPESEFLLALGELEERMKVQYAPSQKDAIQKALSSPMLLL
TGGPGTGKTTVIKGIVELYSELHGVSLDPGDYKKDEAFPVLLAAPTGRAAKRMSESTGLP
AVTIHRLLGWNGAEGFTYNEDQPIEGKLIIIDEASMLDIWLASHLFKALPKHIQLIVVGD
EDQLPSVGPGQVLRDLLASEVLPTVRLTDIYRQAEGSSIVELAHDMKKGLLPKGLTAPTK
DRSFIRCNSAQIKEVVDQVVSNALKKGYTSRDIQVLAPMYRGKAGINELNILLQDIMNPP
KEKRRELKFGDVVYRTGDKILQLVNQPENNVFNGDIGEIVSIFYAKENTEKEDMVVVSFD
GNEITFTKKDFSQFTHAYCCSIHKSQGSEFPIVVLPVVKGYYRMLRRNLLYTAITRAKKF
LILCGEEEALEWGVKNNDATVRQTSLKNRLTEQTEEMDAELAALQKELPFSVYDANIGME
GITPFDFMEEKA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtggatcagctgaaaatcgaggaacaaccgtatgtaaaaggcgttattcatacggtcatt
taccacaatgacaccaacctgtatacagtgctgaaggtcaaggttgcagaaacgtctgag
gcgatcgaagacaaggtcgtatccgtaacgggctacttccctctgctgcaagaagatgag
acttacacattttacggaaaaaccgccacacatcccaagttcggcctgcaattccaggct
gaacactttaaaaaagaaattccgaccaccaaagaagggatcattcactatttatcaagt
gatctgtttgaaggaatcggaaaaaaaacggcggaagaaatcgtcaaaaagcttggagac
ggcgcgctgaataaaattctggctgatgcgtcggtgctttacgatgtgccgaaaatgtcc
aaaaagaaagcggataagcttgccggagagctgcagcggcatcaggggctggagcagatt
atgatttctcttaaccaatacggtttcggacctcagctttccatgaaaatttatcaagct
tacgaaacggaaacccttgagaaaattcaggagaatccttatcagcttgtaaaggacgtg
gaaggcatcggctttgtaaaagccgacgagctgggcggaaaaatgggtctgtcagggaac
catcccgagcggatcaaagcggcgatcttatatacgattgaatcgacctgcctttcagaa
ggtcatacttacatagacacaaagcagctgattatcaatacgcaaacgctactgaatcag
tcagctgacggaggccgcgtcacggaaatggatgcggctgacggcatcatcgccctcgga
gagagtaaggacatcgtcatagaaggagaccgctgctattttccgtctttgttttacgcg
gaacaaaatgtcgcaaaacgcgtgctcgacattgcggctcagacggagtatgccgatcaa
tttcctgaatcggaatttctgcttgcgctcggcgaactggaagaacggatgaaagttcaa
tacgctccgagccaaaaggatgccattcaaaaagcgctgtcgtcgccgatgcttttactg
accggaggaccgggtacgggaaaaacgaccgttatcaaaggaatcgtggaattatacagt
gaactccacggcgtatcgcttgatcccggtgattataaaaaagacgaggcgtttccggtg
ctgcttgccgcgccgaccggaagagccgcaaaacggatgagcgaatctacgggtctgcct
gctgttacgattcacaggctgctcggctggaatggcgctgaaggctttacctacaatgaa
gatcagccgattgaagggaaactgatcattatagacgaagcgagtatgctcgatatttgg
ctcgccagccatttgtttaaggcgctccctaagcacattcagctcatcgtcgtcggtgat
gaagatcagcttccttccgtggggccggggcaggtgctgagagaccttttggcttctgag
gtgctgccgacagtgcgcctgacagatatttaccgtcaggcggaagggtcatccatcgtc
gaacttgctcatgatatgaaaaaaggattgcttccaaaaggactgaccgcgccgacaaaa
gaccgctcatttatccgctgtaattctgcacagattaaagaagtcgtcgatcaagtcgtt
tcaaacgcgttaaagaagggatatacctccagagatattcaagtgcttgcgccgatgtac
aggggaaaagcgggaattaacgagctgaatatacttcttcaagacatcatgaatccgccg
aaagaaaaaaggcgggagctgaaattcggagatgtcgtctacaggacgggcgataaaata
ttgcagcttgtcaaccagccggaaaacaatgtgtttaacggtgatatcggcgaaatcgtg
tccattttttatgccaaagaaaatacggaaaaagaagacatggtcgtcgtctcgtttgac
ggtaatgaaatcacctttacgaaaaaggatttcagccagtttacccatgcttactgctgt
tccatccacaagtctcagggaagtgaatttccgattgtcgtcctgcctgttgtcaaaggc
tactatcgaatgcttaggagaaatctcctttataccgccattacaagggccaagaaattt
ctgatcctttgcggagaagaagaagcgcttgaatggggcgtcaaaaacaatgatgccacc
gtcagacagacgtcgcttaaaaacaggctcacagagcagactgaagagatggatgcagaa
ctggccgctctgcaaaaagaactgccgttcagtgtatatgatgccaacatcggaatggaa
ggcattacgccgtttgactttatggaagaaaaagcgtaa

DBGET integrated database retrieval system